KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0014Help
Entry
NMB0014           CDS       T00027                                 

Gene name
kdtA
Definition
(RefSeq) 3-deoxy-D-manno-octulosonic acid transferase
  KO
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0014 (kdtA)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     NMB0014 (kdtA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     NMB0014 (kdtA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     NMB0014 (kdtA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     NMB0014 (kdtA)
Glycosyltransferases [BR:nme01003]
 Polysaccharide
  Bacterial polysaccharide
   NMB0014 (kdtA)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Core region
  NMB0014 (kdtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(10840..12111)
Genome map
AA seq 423 aa AA seqDB search
MFQWLYDVLWLLAPIWIRRYLDKRSGSAPAYRAHRDERFGKPYPNPVTGAVWIHAVSVGE
TRAAQSLIRELRRRFPDAPLLMTQMTPTGRETAQVLFPDAQCRYLPYDKKTWVRQFLREH
RPMFGILMETEIWPNLMRECRRAGVPLFLANARLSEKSLNGYLKVRRLIRPAAASLTGCL
AQTEADAARLAKLGAASVQVCGNTKYDIIPSEQMKTLAGQFEKRIGGRPVAVCGSTRVYR
GEDEAEKLLAAWQQYRGDALLVVVPRHPEHFQTVFETAKRFGFKVQRRSDGLPVEPDTQV
WIGDSMGELYAYYLCADVAFVGGSLVDSGCQNIIEPLSCGVPTIFGFSTYNFSEACRHAL
ASGAAVQVESADAWREAVEKTLSSEGGGMQMQARVDGFIAQHRGAGARIAEAVREAVCGY
RGR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttccaatggctttatgatgtattgtggctgcttgcgccgatatggatacggcgttat
ttggacaaacgctccggaagtgccccggcatatcgggcgcatcgggacgagcgtttcggc
aagccgtatccgaatcccgttaccggcgcggtttggatacacgccgtttcggtcggagaa
acgcgtgccgcccagtccttgatacgcgagttgcggcggcgttttcccgatgcgccgctg
ctgatgacgcagatgaccccgacggggcgggaaaccgcgcaagttctgtttcccgatgcg
caatgccgctatcttccgtatgacaaaaaaacgtgggtacggcagtttttgcgcgaacac
cgcccgatgttcggcattttgatggaaaccgaaatctggcccaacctgatgagggaatgc
cggcgcgcgggtgtgccgctgtttttggcgaatgcgcggctgtcggaaaaatcgttgaac
ggttatctgaaagtccgccgcctgatccgtcctgccgccgcttcgctgacggggtgtctg
gcgcagacagaggcggatgcggcgcggttggcgaaattgggcgcggcatccgtgcaggtg
tgcggcaataccaaatacgacatcataccgtcggaacagatgaaaacgctggcggggcag
tttgaaaaacgcatcggaggccggccggttgccgtgtgcggcagcacgcgcgtttatcgg
ggtgaagacgaggcggaaaaactgctggcggcgtggcaacaatatcgcggcgatgcgctg
ctggtcgtcgtgccgcgccatcccgagcattttcagacggtatttgaaacggcaaaacgc
ttcgggtttaaggttcagcggcgcagcgacggtttgccggtcgaacctgatacgcaggtg
tggataggcgacagtatgggcgagctgtatgcgtattacctgtgcgccgatgtcgctttt
gtcggcggcagtctggtcgattcgggttgtcagaacatcatcgaaccgctttcctgcggc
gttccgacgatattcggcttttcaacctacaatttttccgaagcctgccgacacgccttg
gcatcgggtgcggcggttcaagtcgaatcggcggatgcgtggcgggaagccgttgaaaaa
accttatcgtccgaggggggggggatgcagatgcaggcgcgcgtggacggctttatcgca
caacatcgcggagcgggcgcgagaatcgccgaggcggtgcgggaagcggtatgcggatat
cgggggcgatag

DBGET integrated database retrieval system