KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0015Help
Entry
NMB0015           CDS       T00027                                 

Gene name
gnd
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0015 (gnd)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0015 (gnd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB0015 (gnd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     NMB0015 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     NMB0015 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(12174..13622)
Genome map
AA seq 482 aa AA seqDB search
MNGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTTAKVDEFLNGAAKGTNIIGAYSLQDL
VDKLEKPRKIMMMVRAGSVVDEFIEQLLPLLEEGDILIDGGNANYPDTTRRTHYLAEKGI
LFVGAGVSGGEEGARRGPSIMPGGDKRAWDAVKPIFQAIAAKTSQGEPCCDWVGKDGAGH
FVKMVHNGIEYGDMQLICEAYQFMKDGLGLSYDEMYRVFAEWNKTELDSYLIEITAAILG
YKDEGGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLISEAVFARCVSSFKEQRVQTG
KLFARTVTPVEGGKQEWVEALRQALLASKIISYAQGFMLIREAGESYGWDLDYGNTALLW
REGCIIRSAFLSNIRDAYENNPDLVFLGADPYFKNILENCLPAWRKVVAKAVECGIPMPC
MASAITFLDGYTTERLPANLLQAQRDYFGAHTYERTDKPRGEFFHTNWTGKGGDTASTTY
DI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgatattggtgtaatcggtttggcggttatggggcaaaacctgattttgaat
atgaacgattgcggatttaaggtggttgcctacaaccgcacgactgccaaggtggacgaa
tttttaaacggcgcggcaaaaggaactaatattatcggcgcgtattctttgcaagatttg
gtcgataagctggaaaaaccgcgaaaaattatgatgatggttcgtgccggttcggtggtt
gacgaatttatcgaacaactgcttccgctgttggaagaaggcgacatccttatcgacggc
ggcaatgccaattaccccgacacgacacggcggacacattaccttgctgaaaaagggatt
ttgtttgtcggcgcgggcgtgtccggcggggaagaaggggcgcggcgcgggccgtccatt
atgccgggcggggataagcgcgcttgggatgcggtcaagccgatttttcaggcgattgcc
gccaaaacgtcgcagggcgaaccgtgttgcgactgggtcggcaaagacggtgcggggcat
tttgtcaaaatggtgcataacggcatcgaatatggcgatatgcagttgatttgcgaagcg
taccagttcatgaaagacggcttggggctgtcttacgacgaaatgtaccgcgtgtttgcc
gagtggaacaaaaccgagctggattcttatctgattgaaatcacagcggcaattttgggc
tataaggacgaaggcggcgaaccgctggtcgagaaaatcctcgatacggcagggcaaaaa
ggtacaggcaaatggacgggcatcaatgctttggatttgggtattccgctgacgctgatt
tccgaagccgtattcgcccgctgcgtttcgtcgttcaaagaacagcgcgtgcagaccggc
aaactgttcgcccgaaccgttacgcccgtcgaaggcggcaaacaagaatgggtcgaggcg
ttgagacaggccctgcttgcatctaaaatcatttcctacgcacaaggctttatgctgatc
cgcgaagcgggcgaaagctacggctgggatttggactacggcaacactgcgctgctgtgg
cgcgaggggtgcatcattcgcagcgcattcttaagcaatatccgcgacgcgtatgaaaac
aatcccgatttggtgttcttgggtgcggatccgtatttcaaaaatattttggaaaactgc
ctgccggcgtggcgcaaggtggttgccaaggcggtcgaatgcggcatccctatgccctgc
atggcttcggcgattacgttcttggacggctacacgaccgaacgtctgcctgccaacctc
ttgcaggcacagcgcgactacttcggcgcgcacacttacgagcgcaccgacaaaccgcgc
ggtgagtttttccataccaactggacgggcaagggcggagataccgcttcgacaacctac
gatatttga

DBGET integrated database retrieval system