KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0017Help
Entry
NMB0017           CDS       T00027                                 

Gene name
lpxC
Definition
(RefSeq) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  KO
K02535  
UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0017 (lpxC)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     NMB0017 (lpxC)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0017 (lpxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(15221..16144)
Genome map
AA seq 307 aa AA seqDB search
MLQRTLAKSISVTGVGLHSGERVALTLHPAPENSGISFRRTDLDGEMGEQIKLTPYLIND
TRLSSTIVTDKGVRVGTIEHIMSALSAYGIDNALIELNAPEIPIMDGSSLPFIYLLQDAG
VVDQKAQKRFLKILKPVEIKEAGKWVRFTPYDGFKVTLTIEFDHPVFNRSSPTFEIDFAG
KSYIDEIARARTFGFMHEVEMMRAHNLGLGGNLNNAIVIDDTDVLNPEGLRYPDEFVRHK
ILDAIGDLYIVGHPIVGAFEGYKSGHAINNALLRAVLADETAYDRVEFADSDDLPDAFHE
LNIRTCG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaagaactttggcgaaatccatcagcgttaccggcgtcgggctgcattcgggc
gaacgcgtcgcgctgaccctgcaccccgcgcctgaaaacagcgggatttccttccgccgt
accgatttggacggcgagatgggcgaacaaatcaagctgaccccttatttgatcaacgat
acccgcctttcctccaccatcgttaccgacaaaggcgtgcgcgtcggcacgatcgaacac
attatgtccgcgctgtccgcctacggcatcgacaatgcgctgattgagctgaacgcgccc
gaaatcccgattatggacggctccagcctgccgtttatttaccttttgcaagatgcgggc
gtggtcgatcaaaaggcgcaaaagcgttttttgaaaatcctcaagcctgtcgaaatcaaa
gaagcgggcaaatgggtgcgctttacgccgtatgacggctttaaggtaacgctgaccatc
gaattcgaccatccggttttcaaccgcagctcgcccacttttgaaatcgatttcgccggc
aaatcctacatcgacgaaatcgcgcgcgcgcgcactttcggctttatgcacgaagtggaa
atgatgcgcgcccacaatctgggtttgggcggcaatttgaacaacgccatcgtgattgac
gacacggatgtcctgaatcctgaaggcttgcgctatcccgatgagtttgtgcgccacaaa
atccttgatgccatcggtgatttgtatatcgtcggacatccgattgtcggcgcatttgaa
ggctacaaatcgggacacgccatcaacaacgcactcttgcgcgcggttttggcagacgaa
acggcttacgaccgggtggaatttgccgacagcgatgatttgcccgacgcatttcacgag
ctgaacatcagaacttgtggataa

DBGET integrated database retrieval system