KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0029Help
Entry
NMB0029           CDS       T00027                                 

Gene name
hprA
Definition
(RefSeq) glycerate dehydrogenase
  KO
K00018  
glycerate dehydrogenase [EC:1.1.1.29]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0029 (hprA)
  Energy metabolism
   00680 Methane metabolism
    NMB0029 (hprA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0029 (hprA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     NMB0029 (hprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
24651..25604
Genome map
AA seq 317 aa AA seqDB search
MNHKKIVVLDADTLPGRVFHFDFPHELAVYGTTGADETAERVRDAHIVITNKVMISADII
AANPQLELIAVSATGVNNVDIGAAKAAGVAVCNVRAYGNESVAEHAFMLMIALMRNLPAY
QRDVAAGLWEKSPFFCHYGAPIRDLNGKTLAVFGRGNIGRTLAGYAQAFGMGVVFAEHKH
ASAVREGYVSFEDAVRAADVLSLHCPLNAQTENMIGENELRQMKPGAVLINCGRGGLVDE
NALLAALKYGQIGGAGVDVLTNEPPKNGNPLLNARLPNLIVTPHTAWASREALDRLFDIL
LANIHAFVKGEAQNRVV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaaagatcgttgttttggatgcggatactttgcccggccgggtttttcat
tttgattttccgcacgagcttgcggtttacggtacgacaggtgcggatgaaacggcagaa
cgggtgcgcgatgcacatattgtcattactaacaaagtgatgatttctgccgatattatt
gcggctaatccgcagttggagctgattgccgtcagtgcgaccggcgtgaacaatgtcgat
attggggcggcgaaggcggccggtgttgcggtatgcaatgtccgcgcatacggaaacgaa
tcggttgcggaacacgcctttatgctgatgattgcgttaatgcggaatttgcctgcctat
cagcgtgatgttgcggcaggattgtgggaaaagtcgccgtttttctgccattacggcgcg
ccgattcgggatttgaacggcaaaacgctggcggttttcggacgcggcaatatcggacgg
acgcttgccggatacgcgcaggcattcggtatgggggtggtgtttgccgaacacaaacac
gcgtccgctgtgcgtgaaggctatgtttcctttgaagatgcggtacgggctgctgatgtg
ttgtcgctgcactgtccgctaaacgcccaaactgaaaatatgataggcgaaaacgaattg
cggcagatgaagcctggcgcggttttaatcaattgtgggcgcggcgggctggtggatgaa
aacgcgctgcttgccgcactcaaatacgggcagatcggtggggcaggtgtcgatgttttg
acgaatgagccgcccaaaaacggcaatcccttgctgaatgcacgattacccaatctgatt
gttacgccgcataccgcgtgggcaagtcgtgaggctttggacaggctgtttgatatattg
ttggcgaacattcacgcctttgtgaaaggagaggcgcaaaaccgcgtggtttga

DBGET integrated database retrieval system