KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0029Help
Entry
NMB0029           CDS       T00027                                 

Gene name
hprA
Definition
(RefSeq) glycerate dehydrogenase
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0029 (hprA)
  Energy metabolism
   00680 Methane metabolism
    NMB0029 (hprA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0029 (hprA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     NMB0029 (hprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD IlvN XdhC_C NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 902132
NCBI-ProteinID: NP_273095
UniProt: Q9K1Q1
Position
24651..25604
Genome map
AA seq 317 aa AA seqDB search
MNHKKIVVLDADTLPGRVFHFDFPHELAVYGTTGADETAERVRDAHIVITNKVMISADII
AANPQLELIAVSATGVNNVDIGAAKAAGVAVCNVRAYGNESVAEHAFMLMIALMRNLPAY
QRDVAAGLWEKSPFFCHYGAPIRDLNGKTLAVFGRGNIGRTLAGYAQAFGMGVVFAEHKH
ASAVREGYVSFEDAVRAADVLSLHCPLNAQTENMIGENELRQMKPGAVLINCGRGGLVDE
NALLAALKYGQIGGAGVDVLTNEPPKNGNPLLNARLPNLIVTPHTAWASREALDRLFDIL
LANIHAFVKGEAQNRVV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaaagatcgttgttttggatgcggatactttgcccggccgggtttttcat
tttgattttccgcacgagcttgcggtttacggtacgacaggtgcggatgaaacggcagaa
cgggtgcgcgatgcacatattgtcattactaacaaagtgatgatttctgccgatattatt
gcggctaatccgcagttggagctgattgccgtcagtgcgaccggcgtgaacaatgtcgat
attggggcggcgaaggcggccggtgttgcggtatgcaatgtccgcgcatacggaaacgaa
tcggttgcggaacacgcctttatgctgatgattgcgttaatgcggaatttgcctgcctat
cagcgtgatgttgcggcaggattgtgggaaaagtcgccgtttttctgccattacggcgcg
ccgattcgggatttgaacggcaaaacgctggcggttttcggacgcggcaatatcggacgg
acgcttgccggatacgcgcaggcattcggtatgggggtggtgtttgccgaacacaaacac
gcgtccgctgtgcgtgaaggctatgtttcctttgaagatgcggtacgggctgctgatgtg
ttgtcgctgcactgtccgctaaacgcccaaactgaaaatatgataggcgaaaacgaattg
cggcagatgaagcctggcgcggttttaatcaattgtgggcgcggcgggctggtggatgaa
aacgcgctgcttgccgcactcaaatacgggcagatcggtggggcaggtgtcgatgttttg
acgaatgagccgcccaaaaacggcaatcccttgctgaatgcacgattacccaatctgatt
gttacgccgcataccgcgtgggcaagtcgtgaggctttggacaggctgtttgatatattg
ttggcgaacattcacgcctttgtgaaaggagaggcgcaaaaccgcgtggtttga

DBGET integrated database retrieval system