KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0031Help
Entry
NMB0031           CDS       T00027                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0031 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0031 (glmS)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     NMB0031 (glmS)
Peptidases [BR:nme01002]
 Cysteine Peptidases
  Family C44
   NMB0031 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(27852..29690)
Genome map
AA seq 612 aa AA seqDB search
MCGIVGAIRAHHNVVDFLTDGLKRLEYRGYDSSGIAVNTDGKIKRVRRVGRVQLMEDAAR
EKGISGGIGIGHTRWATHGGVTEPNAHPHISGGMIAVVHNGIIENFESERKRLEGLGYRF
ESQTDTEVIAHSINHEYAQNGGRLFEAVQEAVKRFHGAYAIAVIAQDKPDELVVARMGCP
LLVALGDDETFIASDVSAVIAFTRRVAYLEDGDIALLASDGIKRLTDKNGLPAERKVKVS
ELSLASLELGLYSHFMQKEIHEQPRAIADTAEVFLDGGFIPENFGKDAKSVFESIRSVKI
LACGTSYYAALTAKYWLESIAKIPSDVEIASEYRYRSVIADSDQLVITISQSGETLDTME
ALKYAKSLGHRHSLSICNVMESALPRESSLVLYTRAGAEIGVASTKAFTTQLVALFGLAV
TLAKVRGLVSEEDEARYTEELRQLPGSVQHALNLEPQIAAWAQQFAKKTSALFLGRGIHY
PIALEGALKLKEITYIHAEAYPAGELKHGPLALVDENMPVVVIAPNDSLLDKVKANMQEV
GARGGELFVFADLDSNFNATEGVHVIRAPRHVGKLSPVVHTIPVQLLAYHTALARGTDVD
KPRNLAKSVTVE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcgtcggcgccatccgcgcccatcacaacgtcgtcgattttctgaccgac
ggtctcaaacgcctcgaataccggggttatgactcatcaggcattgccgtcaacaccgac
ggcaaaatcaaacgtgtgcgccgcgtcggacgcgtgcagcttatggaggacgcggcacgc
gaaaaaggcatcagcggcggcatcggcatcggacatacgcgttgggcgacacacggcggc
gttactgagccgaacgcccacccgcacatcagcggcggtatgattgcggtcgtacacaac
ggcatcatcgaaaactttgaaagcgaacgcaaacgtttggaaggtttgggataccgtttt
gaatcgcaaacggataccgaagtcatcgcacacagcatcaatcacgaatacgcgcaaaac
ggcggcaggctgtttgaagcggtacaagaagcggtcaaacgtttccacggcgcatacgcc
atcgcggttattgcccaagacaagcctgatgaattagttgtggcgcgtatgggctgcccg
cttttggtcgctttgggcgacgatgaaacctttatcgcttcggacgtatccgccgtcatc
gcctttacgcgccgcgtggcgtacctcgaagacggcgacatcgcgctgctggcttcagac
ggcatcaaaaggctgaccgataaaaacggcctgcctgccgaacgcaaagtcaaggtatcc
gaactctcgctcgcctctttggaactgggactgtacagccactttatgcaaaaagaaatc
cacgagcagccccgcgcgattgcagacacggcggaggttttcctcgacggcggcttcatc
cccgaaaacttcggcaaagatgccaaaagcgtgtttgaaagcatccgcagcgtcaaaatc
cttgcctgcggcacgtcctattacgccgcgctgaccgccaaatattggttggaatccatc
gcaaaaatcccgtccgacgtcgaaatcgccagcgaataccgataccgcagcgtgattgct
gattccgaccaactggtcattaccatttcccaatccggcgaaacgctggacacgatggag
gcgttgaaatacgccaaatccttgggacaccgccacagcctctccatttgcaacgtgatg
gaatccgccctgccgcgcgaaagcagcctcgtgctttatacccgtgccggtgcggaaatc
ggcgtcgcctcgaccaaagcgtttaccacgcaactggttgcgctgttcggtttggcggta
acgctggcgaaagtgcgcggtttggtttccgaagaagacgaagcgcgttacaccgaagaa
ctccgccagcttcccggcagcgtgcagcacgctctgaacctcgaacctcaaattgccgca
tgggcgcaacagtttgccaagaaaaccagcgcgctgtttttagggcgcggcatccattac
ccgattgccctcgaaggtgcgttgaagctgaaggaaatcacctacatccacgccgaagcc
tatcctgccggcgaactgaagcacgggccgcttgccctggtggacgaaaatatgcccgtc
gtcgtcatcgcacccaacgacagcctgttggacaaagtcaaagccaatatgcaggaagtc
ggcgcgcgcggcggcgaacttttcgtctttgccgacctcgacagcaattttaatgccacc
gaaggtgtgcacgttatccgcgcaccgcgccacgtcggcaaactgtcccccgtcgtgcat
actatccccgtgcagctcctcgcctaccacaccgccctcgcacgcggtaccgatgtggac
aagccgcgcaacctggcgaaatccgtaaccgtcgaataa

DBGET integrated database retrieval system