KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0031Help
Entry
NMB0031           CDS       T00027                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00250  Alanine, aspartate and glutamate metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0031 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0031 (glmS)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     NMB0031 (glmS)
Peptidases [BR:nme01002]
 Cysteine Peptidases
  Family C44
   NMB0031 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4
Motif
Other DBs
NCBI-GeneID: 902134
NCBI-ProteinID: NP_273097
UniProt: Q9K1P9
Position
complement(27852..29690)
Genome map
AA seq 612 aa AA seqDB search
MCGIVGAIRAHHNVVDFLTDGLKRLEYRGYDSSGIAVNTDGKIKRVRRVGRVQLMEDAAR
EKGISGGIGIGHTRWATHGGVTEPNAHPHISGGMIAVVHNGIIENFESERKRLEGLGYRF
ESQTDTEVIAHSINHEYAQNGGRLFEAVQEAVKRFHGAYAIAVIAQDKPDELVVARMGCP
LLVALGDDETFIASDVSAVIAFTRRVAYLEDGDIALLASDGIKRLTDKNGLPAERKVKVS
ELSLASLELGLYSHFMQKEIHEQPRAIADTAEVFLDGGFIPENFGKDAKSVFESIRSVKI
LACGTSYYAALTAKYWLESIAKIPSDVEIASEYRYRSVIADSDQLVITISQSGETLDTME
ALKYAKSLGHRHSLSICNVMESALPRESSLVLYTRAGAEIGVASTKAFTTQLVALFGLAV
TLAKVRGLVSEEDEARYTEELRQLPGSVQHALNLEPQIAAWAQQFAKKTSALFLGRGIHY
PIALEGALKLKEITYIHAEAYPAGELKHGPLALVDENMPVVVIAPNDSLLDKVKANMQEV
GARGGELFVFADLDSNFNATEGVHVIRAPRHVGKLSPVVHTIPVQLLAYHTALARGTDVD
KPRNLAKSVTVE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcgtcggcgccatccgcgcccatcacaacgtcgtcgattttctgaccgac
ggtctcaaacgcctcgaataccggggttatgactcatcaggcattgccgtcaacaccgac
ggcaaaatcaaacgtgtgcgccgcgtcggacgcgtgcagcttatggaggacgcggcacgc
gaaaaaggcatcagcggcggcatcggcatcggacatacgcgttgggcgacacacggcggc
gttactgagccgaacgcccacccgcacatcagcggcggtatgattgcggtcgtacacaac
ggcatcatcgaaaactttgaaagcgaacgcaaacgtttggaaggtttgggataccgtttt
gaatcgcaaacggataccgaagtcatcgcacacagcatcaatcacgaatacgcgcaaaac
ggcggcaggctgtttgaagcggtacaagaagcggtcaaacgtttccacggcgcatacgcc
atcgcggttattgcccaagacaagcctgatgaattagttgtggcgcgtatgggctgcccg
cttttggtcgctttgggcgacgatgaaacctttatcgcttcggacgtatccgccgtcatc
gcctttacgcgccgcgtggcgtacctcgaagacggcgacatcgcgctgctggcttcagac
ggcatcaaaaggctgaccgataaaaacggcctgcctgccgaacgcaaagtcaaggtatcc
gaactctcgctcgcctctttggaactgggactgtacagccactttatgcaaaaagaaatc
cacgagcagccccgcgcgattgcagacacggcggaggttttcctcgacggcggcttcatc
cccgaaaacttcggcaaagatgccaaaagcgtgtttgaaagcatccgcagcgtcaaaatc
cttgcctgcggcacgtcctattacgccgcgctgaccgccaaatattggttggaatccatc
gcaaaaatcccgtccgacgtcgaaatcgccagcgaataccgataccgcagcgtgattgct
gattccgaccaactggtcattaccatttcccaatccggcgaaacgctggacacgatggag
gcgttgaaatacgccaaatccttgggacaccgccacagcctctccatttgcaacgtgatg
gaatccgccctgccgcgcgaaagcagcctcgtgctttatacccgtgccggtgcggaaatc
ggcgtcgcctcgaccaaagcgtttaccacgcaactggttgcgctgttcggtttggcggta
acgctggcgaaagtgcgcggtttggtttccgaagaagacgaagcgcgttacaccgaagaa
ctccgccagcttcccggcagcgtgcagcacgctctgaacctcgaacctcaaattgccgca
tgggcgcaacagtttgccaagaaaaccagcgcgctgtttttagggcgcggcatccattac
ccgattgccctcgaaggtgcgttgaagctgaaggaaatcacctacatccacgccgaagcc
tatcctgccggcgaactgaagcacgggccgcttgccctggtggacgaaaatatgcccgtc
gtcgtcatcgcacccaacgacagcctgttggacaaagtcaaagccaatatgcaggaagtc
ggcgcgcgcggcggcgaacttttcgtctttgccgacctcgacagcaattttaatgccacc
gaaggtgtgcacgttatccgcgcaccgcgccacgtcggcaaactgtcccccgtcgtgcat
actatccccgtgcagctcctcgcctaccacaccgccctcgcacgcggtaccgatgtggac
aagccgcgcaacctggcgaaatccgtaaccgtcgaataa

DBGET integrated database retrieval system