KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0055Help
Entry
NMB0055           CDS       T00027                                 

Gene name
proC
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  
pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB0055 (proC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     NMB0055 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
59160..59951
Genome map
AA seq 263 aa AA seqDB search
MNVYFLGGGNMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPELHSDDV
LILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPGKIGLG
VSGMYAEAEVSETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQN
AAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRV
AEAISEGVCACVRRSQEMERQYQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttattttctcggcggcggcaatatggcggctgccgttgcgggcggattggtc
aaacaaggcggttaccgcatctatatagccaatcggggtgcggaaaaacgcgaacgtttg
gaaaaagagttgggggtcgaaacttcggcaaccctgccggagcttcattccgacgatgtt
ttaatccttgccgtcaaaccgcaggatatggaagctgcgtgcaaaaatatccgcaccaac
ggcgcattggtgctttctgtcgcagccggattgtcggtcggtacgctcagccgttacctc
gggggaacacgccgcattgtccgggttatgccgaatacacccggaaaaatcgggctgggc
gtatctggtatgtatgccgaagcggaagtatcggaaacagaccgcaggattgccgatcga
atcatgaaatcagtcggtttgactgtttggttggatgatgaggaaaaaatgcacggcatt
accggcatcagcggcagcggaccggcttatgtgttttatctgctggacgcattgcaaaat
gccgccatccgacaagggtttgatatggcagaagcacgcgcgctcagtctggcaacgttt
aaaggagcggttgcccttgccgagcagacgggtgaagatttcgagaagcttcaaaaaaat
gtaacgtcaaaaggcgggacaacccacgaagccgtggaagctttcaggcggcatcgtgtc
gccgaagccataagcgagggcgtttgtgcctgtgtgcgccgttcgcaggaaatggaacgg
caatatcaataa

DBGET integrated database retrieval system