KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0062Help
Entry
NMB0062           CDS       T00027                                 

Gene name
rfbA-1
Definition
(RefSeq) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00521  Streptomycin biosynthesis
nme00523  Polyketide sugar unit biosynthesis
nme00525  Acarbose and validamycin biosynthesis
nme01130  Biosynthesis of antibiotics
Module
nme_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMB0062 (rfbA-1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB0062 (rfbA-1)
   00525 Acarbose and validamycin biosynthesis
    NMB0062 (rfbA-1)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     NMB0062 (rfbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 902169
NCBI-ProteinID: NP_273126
UniProt: P55255
Position
complement(70969..71835)
Genome map
AA seq 288 aa AA seqDB search
MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNAS
FKRLLGDGSDFGISISYAVQPSPDGLAQAFIIGEEFIGNDNVCLVLGDNIFYGQSFTQTL
KQAAAQTHGATVFAYQVKNPERFGVVEFNENFRAVSIEEKPQRPKSDWAVTGLYFYDNRA
VEFAKQLKPSARGELEITDLNRMYLEDGSLSVQILGRGFAWLDTGTHESLHEAASFVQTV
QNIQNLHIACLEEIAWRNGWLSDEKLEELARPMAKNQYGQYLLRLLKK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcatcatactggcaggcggcagcggcacgcgcctctaccccatcacgcgcggc
gtatccaaacagctcctgcccgtgtacgacaaaccgatgatttattaccccttgtcggtt
ttgatgctggcgggaatccgcgatattttggtgattaccgcgcctgaagacaacgcctct
ttcaaacgcctgcttggcgacggcagcgatttcggcatttccatcagttatgccgtgcaa
cccagtccggacggcttggcacaggcatttatcatcggcgaagaatttatcggcaacgac
aatgtttgcttggttttgggcgacaatattttttacggtcagtcgtttacgcaaacattg
aaacaggcggcagcgcaaacgcacggcgcaaccgtgtttgcttatcaggtcaaaaacccc
gaacgtttcggcgtggttgaatttaacgaaaacttccgcgccgtttccatcgaagaaaaa
ccgcaacggcccaaatccgattgggcggtaaccggcttgtatttctacgacaaccgcgcc
gtcgagttcgccaaacagctcaaaccgtccgcacgcggcgaattggaaattaccgacctc
aaccggatgtatttggaagacggctcgctctccgttcaaatattgggacgcggtttcgcg
tggctggacaccggcacccacgagagcctgcacgaagccgcttcattcgtccaaaccgtg
caaaatatccaaaacctgcacatcgcctgcctcgaagaaatcgcttggcgcaacggttgg
ctttccgatgaaaaactggaagaattggcgcgcccgatggcgaaaaaccaatacggccaa
tatttgctgcgcctgttgaaaaaataa

DBGET integrated database retrieval system