KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0067Help
Entry
NMB0067           CDS       T00027                                 

Definition
(RefSeq) polysialic acid capsule biosynthesis protein SiaD
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(76613..77290)
Genome map
AA seq 225 aa AA seqDB search
MLKKIKKALFQPKKFFQDSMWLTTSPFYLTPPRNNLFVISNLGQLNQVQSLIKIQKLTNN
LLVILYTSKNLKMPKLVHQSANKNLFESIYLFELPRSPNNITPKKLLYIYRSYKKILNII
QPAHLYMLSFTGHYSYLISIAKKKNITTHLIDEGTGTYAPLLESFSYHPTKLERYLIGNN
LNIKGYIDHFDILHVPFPEYAKKIFNAKKYNRFFAWRKGDVLQGD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagaaaataaaaaaagctctttttcagcctaaaaagttttttcaagattcaatg
tggttgacaacatctccattttatcttacccccccacgtaacaatttatttgtcatatct
aatttaggtcagcttaaccaagtccaaagcctaattaaaatacaaaaattaaccaataat
ttactagtaattttatatacttctaaaaacttaaaaatgcctaagttagttcatcaatca
gctaacaagaatctatttgaatctatttatctatttgagcttcctagaagccctaataat
ataactcctaaaaaattactttatatttatagaagttacaaaaaaatccttaatattata
cagcctgctcatctctatatgctgtcttttacaggccactactcctatctgattagtatt
gcaaaaaaaaagaatattacgactcatttaattgatgaagggactggaacatatgctcct
ttattagaatcattttcatatcatccaacaaaattagaacgttatttgattggaaataat
cttaatattaaaggatatatagatcattttgacatattgcatgtcccctttcctgaatat
gctaaaaaaatatttaatgcaaaaaaatataaccggttttttgcctggcgaaagggggat
gtgctgcaaggcgattaa

DBGET integrated database retrieval system