KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0071Help
Entry
NMB0071           CDS       T00027                                 

Gene name
ctrA
Definition
(RefSeq) capsule polysaccharide export outer membrane protein
  KO
K01991  
polysaccharide biosynthesis/export protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB0071 (ctrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
80382..81557
Genome map
AA seq 391 aa AA seqDB search
MFKVKFYIRHAVLLLCGSLIVGCSAIPSSGPSAKKIVSLGQQSEVQIPEVELIDVNHTVA
QLLYKAQINQSFTQFGDGYASAGTLNIGDVLDIMIWEAPPAVLFGGGLSSMGSGSAHQTK
LPEQLVTARGTVSVPFVGDISVVGKTPGQVQEIIKGRLKKMANQPQVMVRLVQNNAANVS
VIRAGNSVRMPLTAAGERVLDAVAAVGGSTANVQDTNVQLTRGNVVRTVALEDLVANPRQ
NILLRRGDVVTMITNPYTFTSMGAVGRTQEIGFSARGLSLSEAIGRMGGLQDRRSDARGV
FVFRYTPLVELPAERQDKWIAQGYGSEAEIPTVYRVNMADAHSLFSMQRFPVKNKDVLYV
SNAPLAEVQKFLSFVFSPVTSGANSINNLTN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaagtgaaattttatattcgtcacgcagtattattattgtgtggaagtttaatt
gtaggatgctctgcgattccttcatcaggccccagcgcaaaaaaaattgtctctttaggg
caacaatctgaagttcaaattcctgaagtggagctgattgatgtgaatcatacggttgct
cagttattatataaggctcagataaatcagtcattcactcagtttggcgatggttatgct
tcggctggtacgctaaatattggtgatgtattggatattatgatttgggaagcgccgccg
gcagtattgtttggtggtggcctttcttcgatgggctcgggtagtgcgcatcaaactaag
ttgccagagcagttggtcacggcacgtggtacggtttctgtgccgtttgttggcgatatt
tcggtggtcggtaaaacgcctggtcaggttcaggaaattattaaaggccgcctgaaaaaa
atggccaatcagccacaagtgatggtgcgtttggtgcagaataatgcggcgaatgtgtcg
gtgattcgtgctgggaatagtgtgcgtatgccgctgacggcagccggtgagcgtgtgttg
gatgcggtggctgcggtaggtggttcaacggcaaatgtgcaggatacgaatgtgcagctg
acacgtggcaatgtagtacgaactgttgccttggaagatttagttgcaaatccgcgacaa
aatattttgctgcgtcgcggtgatgtggttaccatgattaccaatccctatacctttacg
tctatgggtgcggtggggagaacacaagaaatcggtttttcagccagaggcttatcgctt
tctgaagccattggccgtatgggcggtttgcaagatcgccgttctgatgcgcgtggtgtg
tttgtgttccgctatacgccattggtggaattgccggcagaacgtcaggataaatggatt
gctcaaggttatggcagtgaggcagagattccaacggtatatcgtgtgaatatggctgat
gcgcattcgctattttctatgcagcgctttcctgtgaagaataaagatgtattgtatgtg
tcgaatgcgccgttggctgaagtgcagaaatttttgtcgtttgtgttctcgccggttacc
agtggcgcgaacagtattaataatttaactaattaa

DBGET integrated database retrieval system