KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0085Help
Entry
NMB0085           CDS       T00027                                 

Gene name
gltS
Definition
(RefSeq) sodium/glutamate symport carrier protein
  KO
K03312  
glutamate:Na+ symporter, ESS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB0085 (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
96815..98029
Genome map
AA seq 404 aa AA seqDB search
MEWEFNSYYTLIAATLVLLVGKFLVQKIKFLRDFNIPEPVAGGLIAAIVLFALHEAYGVS
FKFEKPLQNAFMLIFFTSIGLSADFSRLKAGGLPLVVFTAIVGGFILVQNFVGVGLATAL
GLDPLIGLITGSVSLTGGHGTSGAWGPNFETQYGLVGATGLGIASATFGLVFGGLIGGPV
ARRLINKMGRKPVENKKQDQDDNADDVFEQAKRTRLITAESAVETLAMFAACLAFAEIMD
GFDKEYLFDLPKFVWCLFGGVVIRNILTAAFKVNMFDRAIDVFGNASLSLFLAMALLNLK
LWELTGLAGPVTVILAVQTVVMVLYATFVTYVFMGRDYDAAVLAAGHCGFGLGATPTAVA
NMQSVTHTFGASHKAFLIVPMVGAFFVDLINAAILTGFVNFFKG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaattcaacagttattacacactgattgccgccacgctcgtgttgctggtt
ggtaaatttctggttcaaaaaatcaaattcttacgagacttcaatattcccgagccggta
gccggcggtttgattgccgctatcgtcctgttcgccctgcacgaggcgtacggcgtgagc
ttcaaatttgagaaaccgctgcaaaatgcgtttatgctgatttttttcacgtccatcggc
ttgagcgcggatttttcccgtttgaaggcgggcggtttgccgctggtggtttttaccgcg
attgtgggcggatttatcttggtgcaaaactttgtcggggtcggactggctacggctttg
ggtttggatccgctcatcggtctgattaccggttcggtgtcgctgacgggcggacacggt
acgtcaggtgcgtggggacctaattttgaaacgcaatacggcttggtcggcgcaaccggt
ttgggtattgcatcggctactttcgggctggtgttcggcggcctgatcggcgggccggtt
gcgcgccgcctgatcaacaaaatgggccgcaaaccggttgaaaacaaaaaacaggatcag
gacgacaacgcggacgacgtgttcgagcaggcaaaacgcacccgcctgattacggcggaa
tctgccgttgaaacgcttgccatgtttgccgcgtgtttggcgtttgccgagattatggac
ggcttcgacaaagaatatctgttcgacctgcccaaattcgtgtggtgtctgtttggcggc
gtggtcatccgcaacatcctcactgccgcattcaaggtcaatatgttcgaccgcgccatc
gatgtgttcggcaatgcttcgctttcgcttttcttggcaatggcgttgctgaatttgaaa
ctgtgggagctgaccggtttggcggggcctgtaaccgtgattcttgccgtacaaaccgtg
gtgatggttttgtacgcgacttttgttacctatgtctttatggggcgcgactatgatgcg
gcagtattggctgccggccattgcggtttcggcttgggtgcaacgccgacggcggtggca
aatatgcagtccgtcacgcatactttcggcgcgtcgcataaggcgtttttgattgtgcct
atggtcggcgcgttcttcgtcgatttgattaatgccgcgattctcaccggttttgtgaat
ttctttaaaggctga

DBGET integrated database retrieval system