KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0088Help
Entry
NMB0088           CDS       T00027                                 

Definition
(RefSeq) outer membrane protein P1
  KO
K06076  
long-chain fatty acid transport protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(99777..101177)
Genome map
AA seq 466 aa AA seqDB search
MTPSALKKTVLLLGTAFAAASVHASGYHFGTQSVNAQSTANAAAAEAADASTIFYNPAGL
TKLDSSQISVNANIVLPSIHYEADSATDFTGLPVQGSKSGKITKTTVAPHIYGAYKVNDN
LTVGLGVYVPFGSATEYEKDSVLRHNINKLGLTSIAVEPVAAWKLNDRHSFGAGIIAQHT
SAELRKYADWGIKSKAEILTAKPPKPNGVAEAAKIQADGHADVKGSDWGFGYQLAWMWDI
NDRARVGVNYRSKVSHTLKGDAEWAADGAAAKAMWSTMLAANGYTANEKARVKIVTPESL
SVHGMYKVSDKADLFGDVTWTRHSRFDKAELVFEKEKTVVKGKSDRTTITPNWRNTYKVG
FGGSYQISEPLQLRAGIAFDKSPVRNADYRMNSLPDGNRIWFSAGMKYHIGKNHVVDAAY
THIHINDTSYRTAKASGNDVDSKGASSARFKNHADIIGLQYTYKFK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttccgcactgaaaaaaaccgtcctgctgctcggcactgcctttgccgccgca
tccgtccacgcatccggctaccacttcggcacacagtcggtcaacgcgcaaagcacggca
aatgccgccgccgcagaagccgccgacgcatcgaccatcttctacaaccctgccggcctg
accaaactcgacagcagccagatttccgtcaacgccaacatcgtgctgcccagcattcat
tatgaggcggattccgccaccgactttaccgggcttcccgtccaaggttcgaaaagcggc
aaaatcaccaaaaccacggtcgcgccccacatctacggcgcatacaaagtcaacgacaat
ctgaccgtgggcttgggcgtgtacgtccccttcggctctgccaccgaatacgaaaaagat
tccgtgttgcgccacaacatcaacaaactcggtctgaccagcatcgccgtcgaacctgtc
gccgcgtggaaactcaacgaccgccattccttcggcgcaggcatcatcgcccaacatact
tccgccgaactgcgcaaatatgccgactgggggattaagagtaaagcagagatattgacg
gcaaaaccgcccaaacctaacggtgtagccgaagctgcaaaaattcaggccgacggacac
gccgatgtcaaaggcagcgattggggcttcggctaccaactggcgtggatgtgggacatc
aacgaccgtgcgcgcgtgggcgtgaactaccgttccaaagtctcgcacacgctcaaaggc
gatgccgaatgggcggcagacggcgcggcggcgaaagcaatgtggagtacgatgcttgca
gcaaacggctacacggcgaatgaaaaagcccgcgttaaaatcgttacgcctgagtctttg
tccgtacacggtatgtacaaagtgtccgataaagccgacctgttcggcgacgtaacttgg
acgcgccacagccgcttcgataaggcggaactggtttttgaaaaagaaaaaaccgtcgtc
aaaggcaaatccgaccgcaccaccatcacccccaactggcgcaacacctacaaagtcggc
ttcggcggttcttatcaaatcagcgaaccgctgcaactgcgcgccggcatcgcttttgac
aaatcgcccgtccgcaacgccgactaccgcatgaacagcctacccgacggcaaccgcatc
tggttctccgccggtatgaaataccatatcggtaaaaaccacgtcgtcgatgccgcctac
acccacatccacatcaacgacaccagctaccgcacggcgaaggcaagcggcaacgatgtg
gacagcaaaggcgcgtcttccgcacgtttcaaaaaccacgccgacatcatcggtctgcaa
tacacctacaaattcaaataa

DBGET integrated database retrieval system