KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0107Help
Entry
NMB0107           CDS       T00027                                 

Gene name
pyrI
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00610  
aspartate carbamoyltransferase regulatory subunit
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0107 (pyrI)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0107 (pyrI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
115373..115831
Genome map
AA seq 152 aa AA seqDB search
METPKLSVEAIEKGTVIDHIPAGRGLTILRQFKLLHYGNAVTVGFNLPSKTQGSKDIIKI
KGVCLDDKAADRLALFAPEAVVNTIDNFKVVQKRHLNLPDEIAEVFRCPNTNCAGHGEPV
KSRFYVKKHNGQTRLKCHYCEKTYSRDSVAEA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccgaaactcagtgtcgaagccattgaaaaaggtacggttatcgaccatatt
cccgccggcagggggctgaccatcctgcgccagttcaaacttttgcactacggcaacgcg
gtaaccgtgggcttcaacctgcccagcaaaacccaaggcagcaaagacatcatcaaaatc
aaaggcgtgtgcttggacgacaaagccgccgaccgcctcgccctgttcgcccccgaagcg
gtggtcaacaccatcgacaatttcaaggtcgtgcagaagcggcatttgaacctgcccgac
gaaatcgccgaagtgttccgctgtccgaacacgaattgcgccggccacggcgagccggtc
aaaagccggttttatgttaaaaagcacaacgggcagacgcggctgaaatgccactactgc
gaaaaaacctacagccgggattcggtggcggaagcctga

DBGET integrated database retrieval system