KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0177Help
Entry
NMB0177           CDS       T00027                                 

Definition
(RefSeq) sodium/alanine symporter
  KO
K03310  
alanine or glycine:cation symporter, AGCS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(173681..175072)
Genome map
AA seq 463 aa AA seqDB search
MQVFLDNPKAFFETVSGWVWGPLMLMLLVGTGILLTVLLKGLQFTMLGYALKQAFMPPKK
HKSGEGHEGDISHFAALMTALSATIGTGNIAGVATAVVTGGPGAVFWMWMTAIFGMATKY
GEGVLAVKYRVNNSKGEMSGGPMYYIEKGLGKNWKWMAVAFALFGTFASFGIGSSVQSNS
VAQAVQTSFGIEPAYTGITLTVLTAVVVLGGIKGIAKAASFIVPAMAVFYVLGGLSIIAI
NSDALMPAVKLIFSDAFSAQAVAGGAIGTVIRYGVARGVFSNEAGMGSAPIAAAAAKTDH
PVRQALVSMTGTFLDTIVVCSITGIVLVMGLLGAGGEFVKPEVSGAALTTVTFQKMLPGI
GGWIVTIGLIFFAYSTILGWCYYGEKCAVYVFGEKFAGLYRVGYVSSVMLGTVLSLDLVW
LASDTFNGLMALPNLIALLLMAKVIVNETRDFKQKITNGELPH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgtttttagacaatcccaaagccttttttgaaaccgtcagcggctgggtttgg
ggacctttgatgctgatgctgctggtcggcacgggtattttgctgactgttttattaaaa
ggtttgcagttcacgatgttgggttatgcgctgaaacaggcgtttatgccgccaaagaag
cataaaagcggcgaaggccacgaaggcgatatttcccattttgcggcgttgatgaccgcg
ctgtccgccaccatcggcacgggtaacatcgccggcgtggcgactgcggtggtaaccggc
ggcccgggcgcggtattttggatgtggatgaccgccattttcggcatggccaccaaatac
ggcgaaggcgtgttggcggtgaaataccgcgtcaacaattccaaaggcgaaatgtccggc
ggcccgatgtattacatcgaaaaaggcttgggcaaaaactggaaatggatggccgtcgcg
tttgcgctgttcggcacattcgcttccttcggtatcggcagctcggtgcagtccaactcg
gttgcacaggcggtgcaaaccagcttcggtatcgaacctgcctataccggcattacgttg
accgttctgactgccgttgtcgttttaggtggtattaaaggcatcgccaaagccgcttct
ttcatcgtgcctgctatggcggtgttttatgtgttgggcggtctttccattatcgcgatt
aattccgatgcactgatgcctgccgtcaagctgattttctccgatgcgttcagcgcgcag
gcagtggcgggcggtgctatcggtacggtcatccgctacggcgtggcgcgcggcgtgttc
tccaatgaggcgggtatgggttctgcgcctattgccgccgcagccgcgaaaaccgaccat
cccgtccgtcaggccttggtttctatgaccggtacgtttttggataccatcgtcgtttgc
tcgattaccggcatcgtgttggtaatgggactgctcggcgcgggcggcgagtttgtcaaa
cctgaagtgagcggcgcggcactgacaaccgtcacattccaaaaaatgctgcccggcatc
ggcggctggattgttaccatcggcctgattttctttgcctactcaaccattttgggctgg
tgctattacggcgaaaaatgcgcggtgtatgttttcggcgagaaatttgccggtttgtac
cgcgtgggttatgtttcttccgttatgctgggtaccgtgttgagccttgatttggtgtgg
ctggcttcggacacattcaacggcttgatggcattgcccaacctgattgcacttttattg
atggcgaaagtcatcgtcaatgaaacgcgcgacttcaaacaaaaaatcacaaacggcgaa
ttgccgcattaa

DBGET integrated database retrieval system