KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0178Help
Entry
NMB0178           CDS       T00027                                 

Gene name
lpxA
Definition
(RefSeq) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  
UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0178 (lpxA)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NMB0178 (lpxA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     NMB0178 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0178 (lpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(175429..176205)
Genome map
AA seq 258 aa AA seqDB search
MTLIHPTAVIDPKAELDSGVKVGAYTVIGPNVQIGANTEIGPHAVINGHTSIGENNRIFQ
FASLGEIPQDKKYRDEPTKLIIGNGNTIREFTTFNLGTVTGIGETRIGDDNWIMAYCHLA
HDCVIGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGDYAMTAFAAGVHKDVPPY
FMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQA
ELAVFRDFFAQSARGIIR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatccacccgaccgccgtcatcgaccccaaagccgaactcgactccggcgtc
aaagtcggcgcgtacaccgttatcggccccaacgtccaaatcggcgcgaataccgaaatc
ggtccgcacgccgtcatcaacggccacaccagcatcggcgaaaacaaccgcattttccaa
tttgccagcctcggcgaaatcccgcaggacaaaaaataccgcgacgagccgaccaagctg
attatcggcaacggcaacaccatccgcgaattcaccacctttaatttaggtacggtaacc
ggcatcggcgaaacccgtatcggcgacgacaactggattatggcgtactgccacctcgcg
cacgactgcgtcatcggcaaccacaccattttcgccaacaacgcctcgcttgccggacac
gttaccatcggcgactacgtcgttttgggcggctacacgctggttttccaattctgccgc
atcggcgactacgccatgaccgcgtttgccgcaggcgtacacaaagacgtgccgccctac
tttatggcatcgggctaccgcgccgaaccggcggggctcaacagcgaaggcatgcgccgc
aacggttttaccgcagagcagatttccgccgtcaaagacgtgtacaaaaccctctaccat
cgcggcattccgtttgaagaagccaaggcagacattctccgccgcgccgaaacccaagcc
gagcttgccgtattccgagactttttcgcacaatcggcgcgcggcatcatccgctga

DBGET integrated database retrieval system