KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0179Help
Entry
NMB0179           CDS       T00027                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  
3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NMB0179 (fabZ)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB0179 (fabZ)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0179 (fabZ)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NMB0179 (fabZ)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB0179 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(176292..176741)
Genome map
AA seq 149 aa AA seqDB search
MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVTINEPQFQGHFPDLPVM
PGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSR
RGIGKFNAVAKVDGQVAVEAIIMCAKRVV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacaactccccatcgaagccaaagacatccaaaaactcatcccccaccgctat
ccgtttctccagctcgaccgcatcaccgccttcgagccgatgaaaaccctgaccgcgatt
aaaaacgtcaccataaacgaaccccagttccaaggccatttccccgacctgcccgtgatg
cccggcgtactcatcatcgaagcgatggcgcaggcgtgcggcacgttggcgattttgagc
gaaggcgggcgcaaagaaaacgaattcttcttcttcgccggcatagacgaagcccgtttc
aaacgccaagtcatccccggcgaccaactcgtctttgaagtcgagctgctgaccagccgg
cgcggcatcggcaaattcaacgccgttgccaaagtggacgggcaagttgccgtcgaagcc
atcatcatgtgtgccaaacgcgtggtttga

DBGET integrated database retrieval system