KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0180Help
Entry
NMB0180           CDS       T00027                                 

Gene name
lpxD
Definition
(RefSeq) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0180 (lpxD)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     NMB0180 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0180 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(176775..177821)
Genome map
AA seq 348 aa AA seqDB search
MIPATYTLSQITARLGGEWRGEDISVTAVRPLADAQAEHISFLANPKYKAEVHDSSAGAV
IVSAKAADGFEGRNLIVADDPYLYFAKVARLFSPVVKARGGIHPTAVVEPGATVPTSCEI
GANVYIGANTVLGEGCRILANAVVQHDCKLGDEVVLHPNAVVYYGCTLGRRVEIHSGAVI
GADGFGLAFADDSWFKIPQTGAVTLGDDVEIGSNTNIDRGAMSDTTVGNGTKIDNQVQIG
HNCKIGSHTVIAAKTGISGSVTIGSYCIIGGGVGTVGHIEIADKTTIGGGTSVTHSITES
GKHLAGIFPMSTHKEWARNAVYIHRLSEMNKRLKTLEQQLSDAGQDSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgattccggccacctacaccctgtcccaaatcaccgcgcggctcggcggcgaatggcgc
ggcgaggacatttccgttaccgccgtgcgcccgctcgcagacgcgcaggcggaacacatc
agcttccttgccaatccgaaatacaaagccgaagtccacgacagcagcgcgggcgcggtc
atcgtttccgccaaagcggcagacggatttgaagggcgcaacctgattgtcgccgacgac
ccctatctctatttcgccaaagtcgcccgcctgttttcacccgtcgtcaaagcgcgcggc
ggcatccatccgaccgccgtcgtcgaaccgggcgcgaccgttcccaccagctgcgaaatc
ggcgcgaacgtctacatcggcgcaaacaccgtgctcggcgaaggctgccgcatcttggca
aacgccgtcgtccaacacgattgcaaactgggcgacgaagtcgtcctgcatcccaacgcc
gtcgtttattacggctgcacactgggcagacgcgtcgaaatccacagcggcgcggtcatc
ggcgcggacggtttcggactcgccttcgccgacgattcgtggttcaaaatcccgcaaacc
ggcgcggtaacgctgggcgacgacgtagaaatcggctcgaacaccaacatcgaccgcggc
gcgatgagcgacaccaccgtcggcaacggcaccaaaatcgacaaccaagtccaaatcgga
cacaactgcaaaatcggttcgcacaccgtcatcgccgccaaaaccggcatctcaggtagc
gtaaccataggcagctactgcatcatcggcggcggcgtcggtacggtcggacacatcgaa
atcgccgacaaaaccaccatcggcggcggcacgtccgtcacccacagcattaccgaaagc
ggcaaacacctcgccggcatcttcccgatgtccacccataaagaatgggcgcgcaacgct
gtttacatccaccgcttaagcgaaatgaacaaacggctcaaaacactggagcagcagctt
tcagatgccggtcaagacagcaaataa

DBGET integrated database retrieval system