KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0181Help
Entry
NMB0181           CDS       T00027                                 

Definition
(RefSeq) outer membrane protein OmpH
  KO
K06142  
outer membrane protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(177854..178354)
Genome map
AA seq 166 aa AA seqDB search
MTRLTRAFAAALIGLCCTAGAHADTFQKIGFINTERIYLESKQARKIQKTLDSEFSARQD
ELQKLQREGLDLERQLAEGKLRNAKKAQAEEKWRGLVAAFRKKQAQFEEDYNLRRNEEFA
SLQQNANRVIVKIAKQEGYDVILQNVIYVNTQYDVTDSVIKEMNAR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttgacccgcgcgtttgccgcggctctgatcggtttgtgctgcaccgcaggc
gcgcacgccgacaccttccaaaaaatcggctttatcaacaccgagcgcatctacctcgaa
tccaagcaggcgcgcaagattcaaaaaacgctggacagcgaattttccgctcgtcaggac
gaattgcaaaaactgcaacgcgaaggtctggatttggaaaggcagcttgccgaaggcaaa
ctcagaaacgcaaaaaaggcgcaagccgaagaaaaatggcgcgggctggtcgcagcgttc
cgcaaaaaacaggcgcagtttgaagaagactacaacctccgccgcaacgaagagtttgcc
tccctccagcaaaacgccaaccgcgtcatcgtcaaaatcgccaaacaggaaggttacgat
gtcattttgcagaacgtgatttacgtcaacacccaatacgacgttaccgacagcgtcatt
aaagaaatgaacgcccgctga

DBGET integrated database retrieval system