KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0195Help
Entry
NMB0195           CDS       T00027                                 

Gene name
pdxA
Definition
(RefSeq) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K00097  
4-hydroxythreonine-4-phosphate dehydrogenase [EC:1.1.1.262]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Vitamin B6 metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMB0195 (pdxA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.262  4-hydroxythreonine-4-phosphate dehydrogenase
     NMB0195 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
195140..196147
Genome map
AA seq 335 aa AA seqDB search
MFGANTMKQPVFAVTSGEPAGIGPDICLDLAFARLPCRCAVLGDKNLLRARAEALGKSVV
LRDFDPESGGAAYGELEVLHIPAVEAVEAGKLNPANAAYVLQLLDTALAGISDGIFDGIV
TAPLHKGIINDARASTGFFSGHTEYLAEKSGTGQVVMMLAGKGLRVALVTTHLPLKDVAA
AITQPLIESVARILHHDLKHKFGIKNPKILVAGLNPHAGEGGHLGHEETDTIIPALENLR
REGINLAGPYPADTLFQPFMLEGADAVLAMYHDQGLPVLKYHSFGQGVNITLGLPFIRTS
VDHGTALDLAATGRADSGSLITAVETAVEMARGSL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggagcaaacacgatgaaacagcctgtttttgccgttacttccggcgagcctgcc
ggcatcggccccgatatttgtttggacttggcgtttgcacgcctgccctgccgctgcgcg
gtattgggcgacaaaaacctattgcgcgcgcgcgccgaagccttgggcaaaagcgtcgtc
ctgcgcgacttcgatccagaatcaggcggcgcggcatacggcgagctggaagtgctgcac
atccctgccgtcgaagcggttgaggcgggcaaactcaatcccgccaacgccgcctatgtg
ctgcaacttttggacaccgcgctcgcaggcatttcagacggcattttcgacggcatcgtt
accgcgccgctgcacaaaggcatcatcaacgacgcgcgcgcaagcacaggttttttcagc
ggacacaccgaatatctggcggaaaaaagcggcacggggcaggtcgtgatgatgcttgcc
ggcaaaggcctgcgcgtcgccctcgtaacgacccacctgccgctgaaagacgttgccgcc
gccatcacgcaaccgctgattgaaagcgtcgcacgcattttgcatcacgacttaaaacac
aaattcggcatcaaaaatcccaaaatccttgtcgccggacttaatccccacgccggcgaa
ggcggacacctcggacacgaagaaaccgacaccattatccctgcattggaaaacctgcgc
cgcgaagggataaaccttgccggcccgtatccggcggacacattgttccagccgtttatg
ctcgaaggtgcggatgccgtattggcgatgtaccacgaccaagggctgcccgtgttgaaa
taccacagcttcggacagggcgtgaacatcacgctcggcctgccctttatccgcacctcc
gtcgatcacggcaccgcgcttgatttggcggcaaccggcagggcggattccggcagcctg
ataactgccgtggagaccgccgtcgagatggcgcgcggcagcctttaa

DBGET integrated database retrieval system