KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0199Help
Entry
NMB0199           CDS       T00027                                 

Gene name
lpxB
Definition
(RefSeq) lipid-A-disaccharide synthase
  KO
K00748  
lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0199 (lpxB)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     NMB0199 (lpxB)
Glycosyltransferases [BR:nme01003]
 Polysaccharide
  Bacterial polysaccharide
   NMB0199 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB0199 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
201737..202909
Genome map
AA seq 390 aa AA seqDB search
MWGQTNMADKKSPLIAVSVGEASGDLLGAHLIRAIRKRCPQARFTGIGGELMKAEGFESL
YDQERLAVRGFVEVVRRLPEILRIRRGLVRDLLSLKPDVFVGIDAPDFNLGVAEKLKRSG
IPTVHYVSPSVWAWRRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEFVGHPMAQLMPL
EDDRETARQTLGVDAGIPVFALLPGSRVSEIDYMAPVFFQTALLLLERYPAARFLLPAAT
EATKRRLAEVLQRPEFAGLPLTVIDRQSETVCRAADAVLVTSGTATLEVALCKRPMVISY
KISPLTYAYVKRKIKVPHVGLPNILLGKEAVPELLQSEAKPEKLAAALADWYEHPDKVAA
LQQDFRALHLLLKKDTADLAARAVLEEAGC
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtggggacagacgaatatggctgataaaaaaagccctttgattgccgtcagtgtcggc
gaagcgtcgggcgacctattgggggcgcacctgatacgcgccatccgcaagcgttgtccg
caggcgcggtttaccggtatcggcggcgaactgatgaaggcggaaggtttcgagagcctt
tatgatcaggagcggctggcggtgcgcggctttgtcgaagtggtcaggcggctgccggaa
attttacggatacgcagggggctggtacgggatttgctgtcgttgaaacctgatgtcttt
gtcggtatcgatgcgcccgattttaatttgggtgtggcggaaaagctgaaacggtcgggg
attccgaccgtgcattatgtcagcccgtcggtgtgggcgtggcggcgggaacgtgtgggc
aaaatcgtgcatcaggtcaaccgcgtgttgtgcctgttcccgatggagccgcagctttat
ctcgatgcgggcggacgtgcggagtttgtcggtcatccgatggcgcagcttatgcccttg
gaagacgaccgtgaaacggcgcggcaaactttgggcgtggatgccggcatccccgtattc
gccctgctgcccggcagccgcgtcagcgaaatcgactatatggcgccggtgttttttcag
acggcattattgttgttggaacgctatcccgccgcacgcttcctgctgcctgccgcaacg
gaggcgacgaagcggcgtttggcggaagttttgcagcggccggagtttgccggattgccg
ctgacggtaatcgacagacagtctgaaacagtgtgcagggcggcggatgcggtgctggta
acgagcggtacggcaactttggaggtggcgttgtgtaagcgtccgatggtcatcagctac
aagatttcgccgctgacctatgcttatgtgaaacgcaaaatcaaagtgccgcatgtcggc
ctgccgaatatcctgttgggtaaggaggctgtgccggaattattgcaatctgaagcaaaa
ccggaaaaactggcggcggcgttggcggactggtacgaacaccccgataaggttgccgcg
ctgcaacaggatttcagggcgttgcacctgctgttgaaaaaagatacggcggatttggcc
gcgcgcgcggttttggaagaggcgggatgttga

DBGET integrated database retrieval system