KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0203Help
Entry
NMB0203           CDS       T00027                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase
  KO
K00215  
4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0203 (dapB)
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0203 (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB0203 (dapB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     NMB0203 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(204405..205214)
Genome map
AA seq 269 aa AA seqDB search
MTPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLKTGIAIS
DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDTGKAAIHTAAEKTGI
VFAANFSVGVNLTFHILDTVARVLNEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGALG
RDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRMTF
AAGAVRAAVWVNGKTGLYDMQDVLGLNNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctcaaaatcgccatcgccggcgcaaacggccgtatgggacgcgtattggtt
gaagccgtcaacaaccatcccgacaccgtcctttccggtgcgcttgaacactcaggctca
gaagccctcgggctggacgcaggctacgccgtcggactcaaaaccggcatcgccatttca
gacgacgttgacgccgttctcgcacaaagcgacgtactcatcgacttcacccgccccgag
cccaccctcaaacacctgcaaaaatgcgttgaaaaacaagtcaacatcatcatcggcaca
acaggcttcgacgatacgggcaaagccgctatccacactgccgccgaaaaaacaggcatc
gttttcgccgccaacttcagcgtcggcgtcaacctcaccttccacatcctcgacaccgtc
gcacgcgtattaaacgaaggctacgacatcgaaatcattgaaggccaccaccgccacaaa
gtcgatgcccccagcggcaccgcgttacgcatgggcgaagtcatcgccggcgcgctcggc
agagacctcaaacaatgcgccgtttacggccgcgaaggccacaccggtccgcgcgatccg
tcgaccatcggctttgccaccgtccgcgcaggcgacatcgtcggcgaccacaccgccctc
ttcgccaccgacggcgagcgcgtggaaatcacccacaaggccagcagccgcatgaccttt
gccgccggtgccgtccgcgccgcagtttgggtcaacggcaaaacgggtttgtacgatatg
caggacgtactcgggctgaacaaccgttaa

DBGET integrated database retrieval system