KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0207Help
Entry
NMB0207           CDS       T00027                                 

Gene name
gapA-1
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0207 (gapA-1)
   01230 Biosynthesis of amino acids
    NMB0207 (gapA-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0207 (gapA-1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     NMB0207 (gapA-1)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB0207 (gapA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(207302..208333)
Genome map
AA seq 343 aa AA seqDB search
MGIKVAINGYGRIGRQVLRAIYDYQIQDQLQIVAVNASGSLETNAHLTKFDTVHGRFEAD
VSHDGGNLIVNGDKIPFFSTRNPAELPWKELGVDLVMECTGAFTSKEKAKIHLESGAKKV
LISAPGGDDVDATVVYGVNDSVLTADMTVVSNASCTTNCLSPVAKVLSESVGIVKGAMTT
IHALTNDQTVTDVRHKDLRRARSGVENMIPTKTGAAKAVGLVLPELKGRLDGLAIRVPTV
NVSLVDLSFQAARDTTVEEINALMKAASEAGPLKGVLGYNTLPLVSMDFNHTTEASHFDA
TLTKVVDGNMVKVFAWYDNEWGFSCQMLNTARRMFGLEVRPLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcaaagtcgccatcaacggctacggacgcatcggccgccaggttttgcgcgcc
atctacgattatcagattcaagaccaactccaaatcgtcgccgtcaacgccagcggcagc
cttgaaaccaacgcccatctgaccaaattcgacaccgtgcacggacgctttgaagccgac
gtatcccacgacggcggcaacctcatcgtcaacggcgacaaaatccccttcttctcgacc
cgcaaccctgccgaactgccgtggaaagaactcggtgtcgatttggtcatggaatgcacc
ggcgcgttcaccagcaaagaaaaagccaaaatccacctcgaaagcggcgcgaaaaaagtc
ctcatttccgcaccgggcggcgacgatgtcgatgcaaccgtcgtgtacggcgtgaacgac
agcgtcctgaccgccgacatgaccgtcgtttccaacgcttcctgcaccaccaactgcctc
tcgccggttgccaaagtgttgagcgaaagcgtcggcatcgtcaaaggcgcgatgaccacc
atccacgcgctgaccaacgaccaaaccgttaccgacgtgcgccacaaagacctgcgccgc
gcccgcagcggcgtggaaaacatgattccgaccaaaaccggcgcggcaaaagccgtcggt
ttggtactgcccgaattgaaaggcaggctcgacgggcttgccatccgcgtgccgaccgtc
aacgtatcattggtagatttgagcttccaagccgcgcgcgacaccacagtcgaagaaatc
aacgcactgatgaaagccgcctcggaagcaggcccgctcaaaggcgttttgggctacaac
accctgcccttggtttccatggacttcaaccacactaccgaagccagccacttcgacgca
acactgaccaaagtcgttgacggcaacatggtcaaagtgttcgcttggtatgacaacgaa
tggggcttcagctgccaaatgctgaacaccgcacgccgtatgttcggacttgaagtgcgc
ccgctcaaataa

DBGET integrated database retrieval system