KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0209Help
Entry
NMB0209           CDS       T00027                                 

Gene name
kefB
Definition
(RefSeq) glutathione-regulated potassium-efflux system protein
  KO
K03455  
monovalent cation:H+ antiporter-2, CPA2 family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
209520..211496
Genome map
AA seq 658 aa AA seqDB search
MNEFSLAPIVIVLLVSVITVILCRKFNIPSMLGYLLVGFLAGPGMLSLIPKSHATDYLGE
IGIVFLMFSIGLEFSLPKLRAMRRLVFGLGGLQVGITMLSVMGILMLTGVPFNWAFAVSG
ALAMSSTAIVSRILSEKTELGQPHGQMAMGVLLMQDIAVVPLMILIPALAGGGDGNIWAA
LGLAFAKMLLTLGLLFFVGSKIMSRWFRMVAKRKSSELFMINVLLVTLGVAYLTELEGLS
MALGAFVAGMLLSETEYRFQVEDDIRPFRDILLGFFFITVGMKLDIQALIGGWRQVLMLL
AMLLVLKALVVFAIAFKMKHSVGDSLKTALYLAQGGEFGFVMLAIAGQLDMVSPEWEQAA
TAAVLLSMIIAPFLLGGSDALVGRLVKSSWDMKSLDLHSMLVETMSKSDHVLIVGFGRGG
QTVGRVLAQEDIPYFALDLDIARVQVARSAGEPVSFGDAKRREVLEAAGLGRAKMVVVTL
NNMHETQHVLDNVLSMYPNMPVYVRATNDDYVKTFTDIGAEEAVSDTKETGLVLAGYAML
GNGASYRHVYQTMANIRHSRYAALEGLFVGSDDEAGFGENGETVRHAFPLAAEAYAVGKT
VGTLPMAAYGIKLLFVRRRTGRIENPDASFTLEGGDVLVVAGKKEEIISFENWSLQGI
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaattttcgcttgcccctattgtgattgttttgctggtgtcggtcattacggtg
atcctgtgccgcaagttcaacattccctccatgctgggctacctgctggtgggctttttg
gcggggcccggtatgctcagcctgattccgaaaagccatgcgacggattatttgggcgaa
atcgggattgtgttcctgatgttcagcatcggtttggagttctcgctgcccaagttgagg
gcgatgaggcggctggtgttcggtctgggcggtttgcaggtcggcattacgatgctgtcg
gtaatgggcatactgatgctgacgggcgtgccgttcaattgggcgtttgccgtgtcgggc
gcgttggcgatgtcgtccacggcgattgtgagccggattttgtcggaaaagacggaattg
gggcagccgcacggtcagatggcgatgggcgtgctgctgatgcaggacatcgccgtcgtg
ccgctgatgattctgattcccgcgctggcgggcggaggggacggaaatatttgggcggcc
ttgggtttggcgtttgcaaaaatgctgctgacgctggggctgctgtttttcgtcggcagc
aaaattatgtcgcgatggttcaggatggtggcaaaacgcaaatcgtccgaactctttatg
atcaatgtgctgctggtaaccttgggtgtggcttatctgactgagctggaaggtttgtct
atggcgttgggcgcattcgttgccggcatgctgctttcggaaacggaataccgtttccaa
gtcgaagacgacatccgcccgttccgcgatattttgctcggctttttctttatcacggtc
ggcatgaagctggacattcaggcattgatcggcggctggcggcaggtattgatgctgttg
gcaatgctgctggtgttgaaggcactggttgtgtttgccattgccttcaaaatgaaacat
tcggtcggcgacagcctcaaaacggctttgtatctcgcgcagggcggcgagttcggcttc
gtgatgctggccattgccgggcagcttgatatggtttcgccagaatgggaacaggcggcg
acggcggcggttctgctgtcgatgattatcgcgcccttcctcttgggcggcagcgatgcg
ctggtcgggcgtttggtcaagtcaagctgggacatgaagtcgctcgatctgcacagtatg
ctggtagaaaccatgagcaagtccgaccatgtgctgattgtcggcttcggcaggggcggg
cagacggtcggacgcgtccttgcccaagaggatattccgtatttcgcgctcgacttggac
attgcgcgggtgcaggttgccagaagtgcgggcgaaccggtgtcgttcggcgatgcgaaa
cgcagggaagtattggaagccgccggtctgggacgggcgaaaatggtggtggttacgctc
aacaatatgcacgaaacgcaacacgttttagacaatgtgctgtccatgtatcccaatatg
cccgtatatgtgcgcgccaccaacgacgattatgtgaaaacgtttaccgatataggtgcg
gaagaagccgtgtcggacaccaaagaaaccggactcgtgctggcaggctatgcaatgtta
ggcaacggcgcgtcgtatcggcacgtctatcagacgatggcaaatatccgccacagccgt
tatgccgcgttggagggactgtttgtcggtagtgatgatgaggcaggattcggcgaaaac
ggcgaaaccgtccgtcacgcctttcctttggctgcagaagcatacgccgtcggcaaaaca
gtcggcacgcttccgatggcggcttacggcatcaaactcttgttcgtccgccgccgcacc
ggccggattgaaaacccggatgcctcgtttacattggaaggcggtgacgtgttggtggtc
gcaggcaaaaaagaagaaattatctcttttgaaaactggagtttgcagggaatataa

DBGET integrated database retrieval system