KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0211Help
Entry
NMB0211           CDS       T00027                                 

Gene name
sdaA
Definition
(RefSeq) L-serine dehydratase
  KO
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0211 (sdaA)
   01230 Biosynthesis of amino acids
    NMB0211 (sdaA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0211 (sdaA)
   00270 Cysteine and methionine metabolism
    NMB0211 (sdaA)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     NMB0211 (sdaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(212715..214100)
Genome map
AA seq 461 aa AA seqDB search
MISIFDIFKIGIGPSSSHTVGPMKAAAAFAAGLDAQAVRIVIDIYGSLALTGYGHGTFDA
LMLGLEGSLPHDIPLAGIPERLERIRTQHILRLNGQEIRFIPDRDLNILGNQVLPKHPNS
LRFTAYASDGTVLNEQVYYSVGGGFVVTEEDFDRQAETEKAVPYPYTSCAELLARCRLNR
LDISEVVLANEAALAGCGEAEIRRRAAAVAEVMEGCIKRGLGADGELPSGLNVRRRAPQL
AAKLKVLRETEIVNTQLWPMVYAMAVNEENAAGGRVVTAPTNGAAGIIPAVLHYFRKFNP
HATQERVENFLLTAGAIGILYKTNASISGADVGCQGEVGVACSMAAGAYAEVIGGTPKQV
ENAAEMAMEHHLGLTCDPVGGLVQIPCIERNGIAAEKALKLGTLALLEDGTDKKVSLDEV
IRTMLQTGRDMKATYKETSLAGLAATLRKKAVPVSVRVVEC
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcattttcgatattttcaaaatcggtatcgggccttccagttcgcatacggtc
ggcccgatgaaggcagccgccgcctttgcggcaggtttggatgcacaggctgttcgcatc
gtcatcgacatttacggctcgctcgcactgaccggatacggacacggtacatttgacgcg
ctgatgctcggtttggaaggcagcctgccgcacgacatcccgcttgccggcattcccgaa
cgcctcgaacgcatccgcacgcagcacatcctccggctcaacgggcaagaaatccgcttc
atccccgaccgcgacctgaacatactcggcaatcaagtgctgcccaaacaccccaacagc
ctgcgttttaccgcctatgcttcagacggcacggtattgaatgaacaggtttattattcg
gtcggcggcggctttgtcgttaccgaagaagattttgaccggcaggcggaaacggaaaaa
gccgttccctatccctataccagttgcgccgaactgcttgcccgatgccgtctgaaccgg
ctcgacatctccgaagtcgtgttggcaaacgaagccgcgcttgccggatgcggcgaagcc
gaaatccgccgccgcgccgctgccgttgccgaggttatggaaggctgcatcaaacgcggc
ttgggtgcggacggcgaactgcccagcggattgaacgtccgccgccgcgccccgcagctt
gccgccaagctcaaagtcctgcgcgaaaccgaaatcgtcaacacccagctctggccgatg
gtgtacgccatggcggtcaacgaagaaaacgccgccggcggacgcgtcgttaccgcaccg
accaacggcgcggcaggcatcattcccgccgtattgcactatttccgcaagttcaatccg
cacgccacacaggaacgcgtcgaaaacttcctgctcaccgcaggcgcaatcggcatcctc
tacaagaccaacgcctccatttccggtgcggatgtcggctgtcagggcgaagtcggcgta
gcgtgttcgatggcggcgggcgcatacgccgaagtcatcggcggcacgcccaaacaagtg
gaaaacgccgccgaaatggcgatggaacaccatttggggctgacttgcgaccccgtcggc
ggactggtgcaaatcccctgcatcgagcgcaacggcatcgccgccgaaaaagccctcaaa
ctcggcacgctcgcgcttttggaagacggcacggacaaaaaagtctcgctcgacgaagtc
atccgaaccatgctgcaaaccggccgggatatgaaggcgacctacaaagaaacctcgctt
gccggactcgccgccacgctccggaaaaaagccgtccccgtatccgtgcgcgtggtcgag
tgctga

DBGET integrated database retrieval system