KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0216Help
Entry
NMB0216           CDS       T00027                                 

Gene name
kat
Definition
(RefSeq) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB0216 (kat)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0216 (kat)
  Amino acid metabolism
   00380 Tryptophan metabolism
    NMB0216 (kat)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NMB0216 (kat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(221438..222952)
Genome map
AA seq 504 aa AA seqDB search
MTTSKCPVTHLTMNNGAPVADNQNSLTAGPRGPLLAQDLWLNEKLADFVREVIPERRMHA
KGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTVAGERGAADAERDIRGFALKF
YTEEGNWDVVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRSATNNWDFWTLLPEALHQV
TIVMSDRGIPAGYRHMHGFGSHTYSFWNEAGERFWVKFHFRTQQGIKNLTNEEAAKIIAD
DRESHQRDLYEAIERGEFPKWTMYIQVMPEADAEKVPYHPFDLTKVWPKKDYPLIEVGEF
ELNRNPENFFADVEQSAFAPSNLVPGVGASPDKMLQARLFNYADAQRYRLGVNFRQIPVN
RPRCPVHSNQRDGQGRADGNYGSLPHYEPNSFGQWQQQPDFAEPPLKINGDAAHWDYRQD
DDDYFSQPRALFNLMNDAQKQALFGNTAAAMGDAPDFIKYRHIRNCYRCDPAYGEGVAKA
LGLTVEDAQAARATDPALGQAGLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactacctccaaatgccctgtaacccatctgaccatgaacaacggcgcgcctgttgcc
gacaatcaaaacagcctgaccgccggtcctcgcggccctctgctggcgcaggatttgtgg
ctgaatgaaaaactcgccgacttcgtgcgcgaagtcatccccgaacgccgtatgcacgcc
aaaggttcgggcgcgttcggtacgtttaccgtaacgcacgacatcaccaaatacacccgc
gccaaaatcttcagcgaagtcggcaaaaaaaccgagatgttcgcccgtttcaccaccgtg
gcaggcgaacgcggcgcagccgatgcagaacgcgacatccgcggttttgccttgaaattt
tataccgaagaaggcaactgggatgtggtcggcaacaacacgcccgtgttcttcctgcgc
gacccgcgtaagttccccgacctgaacaaagccgtcaaacgcgacccgcgcaccaatatg
cgctctgccacaaacaactgggacttctggacgctgctgcccgaagcactgcaccaagtt
accatcgtgatgagcgaccgcggcatccccgccggctaccgccatatgcacggcttcggt
tcgcatacctacagcttctggaacgaagcaggcgagcgtttttgggtgaaattccatttc
cgcacccaacaaggcattaaaaacctgaccaacgaagaagccgccaaaatcatcgccgac
gaccgcgaaagccatcagcgcgacttatacgaagccatcgaacgcggcgagtttccgaaa
tggacgatgtacatccaagtcatgcctgaagcagacgcggaaaaagtaccttatcatccg
tttgacttgaccaaagtttggccgaaaaaagactatccgctgattgaagtgggcgaattc
gagttgaaccgcaatcccgaaaacttcttcgccgatgtggaacaatccgccttcgcaccg
agcaacctcgttcccggtgtcggcgccagcccagataaaatgctgcaagcgcgtttgttc
aattacgccgacgcacaacgctaccgtttgggcgtaaacttccgccaaattcccgtcaat
cgtccgcgttgccctgttcacagcaaccagcgcgacgggcaaggccgcgccgacggcaac
tacggcagcctgccgcactacgaacccaacagcttcggccaatggcagcaacaacccgac
ttcgccgaaccgcctttgaaaatcaacggcgacgcggcacactgggactaccgccaagac
gatgacgactatttcagccaaccgcgcgccctgttcaacctgatgaacgacgcgcagaaa
caggcattgttcggcaacaccgccgccgcaatgggcgacgcgcccgacttcatcaaatac
cgccatatccgcaactgctaccgttgcgacccggcatacggcgaaggcgtggccaaagcc
cttggactgactgtcgaagatgcccaagccgcccgcgcgaccgatcccgcactgggtcag
gctggtttgctgtaa

DBGET integrated database retrieval system