KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0219Help
Entry
NMB0219           CDS       T00027                                 

Gene name
fabF-1
Definition
(RefSeq) 3-oxoacyl-ACP synthase
  KO
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB0219 (fabF-1)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0219 (fabF-1)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     NMB0219 (fabF-1)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB0219 (fabF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(226506..227753)
Genome map
AA seq 415 aa AA seqDB search
MSQRRVVITGLGQVSPVGNTVAEAWDTLLTGKSGIGAITRFDTSDINSRVAGEVRGFDIG
QYISAKEARRMDVFIHYGIAAALQAIADSGLDDVENLDKDRIGVNIGSGIGGLPGIEVTG
KAVIEGGARKINPFFIPGSLINLISGHVTILKGYRGPSYGMVSACTTGAHAIGDSLRMIK
YGDADIMVAGGAEGAISTLGVGGFAAMKALSTRNDDPATASRPWDKGRDGFVIGEGAGIL
VLEELEHAKKRGAKIYAEIVGFGMSSDAYHITAPNEEGPALAVTRALKDAGINPEDVDYV
NAHGTSTPLGDANETKALKRAFGEHAYKTVVSSTKSMTGHLLGAAGGVEAVYSILAIHDG
KIPPTINIFEQDVEAGCDLDYCANEARDAEIDVAISNSFGFGGTNGTLVFKRFKG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagagaagagtagtcattacaggcttaggtcaggtttcccctgtcggcaacact
gtcgcagaggcttgggacaccctgctcaccggcaaaagcggcatcggcgcgattacccgc
tttgacacatccgacatcaacagccgtgtcgccggcgaggtgcgcggtttcgacatcgga
caatacatcagcgcgaaagaagcgcgccggatggacgtattcatccactacggcattgcc
gccgcattgcaggcaatcgccgattcgggtttggacgatgtggaaaacctcgacaaagac
cgcatcggcgtgaacatcggttccggcatcggcggactgcccggcatcgaggtcaccggc
aaagccgtaatcgaaggcggcgcgcgcaaaatcaaccctttctttatccccggttctctg
attaatctgatttccggacacgttaccatcctcaaaggctaccgcggcccgagctacggg
atggtttccgcctgcaccaccggcgcgcacgccatcggcgattccctccgtatgattaaa
tacggcgacgcggacataatggttgccggcggcgcggaaggcgcaatcagcactttgggc
gtgggcggttttgccgcgatgaaagccctctccacccgcaacgacgaccccgccaccgct
tcccgtccgtgggacaaaggccgcgacggcttcgttatcggcgaaggcgcgggcatattg
gtgttggaagaattggaacacgccaaaaaacgcggcgcgaaaatctacgccgaaatcgtc
ggcttcggcatgagttccgatgcttaccatatcaccgcgccgaacgaagaaggccccgcc
cttgccgttacccgcgcgctgaaagatgccggcatcaatcccgaagacgtggattacgtc
aacgcgcacggcacgtccacccccttgggcgatgccaacgaaaccaaagccctcaaacgc
gcgttcggcgaacacgcctacaaaaccgtcgtcagctcgaccaaatccatgaccggccac
ctgctcggcgcggcgggcggcgtggaggccgtgtacagcattttggcgatacacgacggc
aaaatcccgccgaccatcaacatttttgaacaagacgttgaagccggctgcgatttggac
tactgcgccaacgaagcgcgcgacgcggaaatcgacgttgccatttccaactccttcggc
ttcggcggcaccaacggcacgctggtcttcaaacgcttcaaaggctga

DBGET integrated database retrieval system