KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0221Help
Entry
NMB0221           CDS       T00027                                 

Gene name
pyrD
Definition
(RefSeq) dihydroorotate dehydrogenase 2
  KO
K00254  
dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0221 (pyrD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     NMB0221 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
228377..229384
Genome map
AA seq 335 aa AA seqDB search
MYPLARRILFALDAEKAHHFTLDALYTVYKLGLIPVTDNRTKPVKLMGMDLPNPVGLAAG
LDKNGEYIDALGALGFGFIEIGTVTPNPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDTM
IRNIEKSKFSGVLGINIGKNAVTPIENAADDYLICLEKAYAHASYITVNISSPNTKNLRA
LQGGDELSALLEALKNKQAQLASVHGKYVPLAVKIAPDLDEAQIEDIAHVVKSVEMDGII
ATNTTIDKSSLGSHPLAGEQGGLSGLPVHEKSNRVLKLLADHIDGKLPIIGVGGIMEGED
SADKIRLGATAVQVYSGLIYKGPALVKECLKALAR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtatccacttgcccgtcgcatcctgtttgcactcgatgccgaaaaagcccaccacttc
acgctcgacgcgctctacacggtttataaattgggtttgattcctgtaaccgacaaccgt
accaaacctgtaaaattgatgggtatggatttgcccaaccctgtcggacttgccgccgga
ctcgacaaaaacggcgaatacatcgacgcattgggcgcgctcggctttggtttcatcgaa
atcggcacggtaacgcccaacccgcagcccggcaacccgcagccgcgcctctttcgcgtt
cccgaacaccaaggcatcatcaaccgcatgggtttcaacaaccacggtatcgacaccatg
atacgcaacatcgaaaaaagtaaattcagtggcgtattgggcatcaacatcggtaaaaac
gcggttacacccatcgaaaacgctgccgatgattatttaatctgccttgaaaaagcctac
gcacacgcaagttacattaccgtcaatatttcctcgcccaacactaaaaacctccgcgcg
ctgcaaggtggcgacgagttgagcgcattgcttgaggctttgaaaaacaaacaggcacag
cttgcctctgtacacgggaaatacgtcccgctcgccgtcaaaatcgcccccgatttggat
gaagcacaaatcgaagacatcgcccacgttgtcaaatccgtcgaaatggacggcatcatc
gctaccaataccaccatcgacaaatcaagtctcggcagccatccgctcgcaggcgagcag
ggcggtttgagcgggctgcccgttcatgaaaaaagtaatcgggtgttgaagctgttggca
gaccacatagacggcaagctgccgattatcggcgtaggcggcattatggaaggcgaggac
tcggcagataaaatccgcttgggcgcgaccgccgtccaagtgtacagcggattgatatac
aaaggtccggcattggtcaaagaatgtttgaaggctttggcgcgatga

DBGET integrated database retrieval system