KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0241Help
Entry
NMB0241           CDS       T00027                                 

Gene name
nuoA
Definition
(RefSeq) NADH dehydrogenase subunit A
  KO
K00330  
NADH-quinone oxidoreductase subunit A [EC:1.6.5.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB0241 (nuoA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     NMB0241 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
246614..246970
Genome map
AA seq 118 aa AA seqDB search
MLSAYFPVFVFILIGLAAGVLFILLGTILGPKRHYAEKDAPYECGFEAFENARMKFDVRY
YLVAILFILFDLEVAFMLPWAVVFKDLGAYGFWSMLVFIVVLTVGFVYEWKKGALEWE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgcttactttcccgtctttgtctttatcctcatcggcctcgcggccggcgtg
ctgtttatcctgctcggcacgattttaggcccgaaacgccactatgccgaaaaagacgcg
ccttacgaatgcggttttgaagcttttgaaaacgccaggatgaagttcgacgtgcgctat
tacctcgtcgccatcctcttcatcctgtttgatttggaggtcgcgtttatgctgccgtgg
gcagtcgtgttcaaagatttgggcgcgtacggcttctggtctatgctggtgtttatcgtt
gttctgacggtaggctttgtttacgaatggaaaaaaggtgcgctggaatgggaatag

DBGET integrated database retrieval system