KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0261Help
Entry
NMB0261           CDS       T00027                                 

Gene name
ispA
Definition
(RefSeq) geranyltranstransferase
  KO
K00795  
farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0261 (ispA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     NMB0261 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     NMB0261 (ispA)
Prenyltransferases [BR:nme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMB0261 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(265091..265870)
Genome map
AA seq 259 aa AA seqDB search
MRYAALDGGKRLRPMLVLAASELGEAVHEAVEQAMAAIEMIHVYSLVHDDMPAMDNDSLR
RGKPTCHIKYGEATALLTGDALQTQAFDVLSRPTELPAARQLAMLSVLAKAGGSRGMAGG
QAIDLANVGKQMVQADLEQMHSLKTGALIRAAVLLGATACPDLSDAELSVLDAYAAKLGL
AFQVIDDVLDCEADTATLGKTAGKDADNDKPTYVKLMGLEAARSYAHKLVAEAVALLEPF
GDKALRLRQLAEFAVARKY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgcggctttggacggcggtaagcgtctgcggccgatgctggttctggcagct
tcggaattaggcgaagccgtgcatgaagcagtagaacaggcaatggcggcaatcgaaatg
atccacgtctattctttggttcacgacgatatgccggcgatggacaacgacagcctgcgg
cgcggcaaaccgacttgccacatcaaatatggcgaagcgaccgcccttctgaccggcgac
gctttgcagacacaggcatttgacgtgttgagccgtccgacagaactgcccgccgcacgc
cagttggcaatgttgtcggtgttggcgaaagcgggcggcagcaggggtatggcgggcggt
caggcaatcgatttggcgaatgtcggcaaacaaatggttcaagccgatttggaacagatg
cacagcctgaaaacgggtgcgctaatccgtgcggcggttttattgggggcgacggcgtgt
cctgatctgtcagatgcggaactttccgtattggacgcttacgcggcaaaactggggctg
gcgttccaagtcattgacgatgtgttggattgtgaagcggacacggcgactttgggcaaa
acggcgggcaaagacgcagacaacgacaagccgacttatgtgaaactgatgggcttggaa
gcggcgcgctcatacgcacacaaactggttgccgaagcggtcgcgctgctcgaacccttc
ggcgacaaagccctgcgcctgcggcagttggcagaatttgcagtcgcccgcaaatattaa

DBGET integrated database retrieval system