KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0265Help
Entry
NMB0265           CDS       T00027                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(269389..269973)
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAAPAADETEDIVSTLLALGYSEREAKAAVKGVPEGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaggccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcaatgactgccgacgaactggcgcgg
gcggttgcagaagaagatgtcaaacgcctctcctccgccccgggaatcggcaaaaaaacc
gccgaacgtatggttttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacagcgaacgcgaagcaaaagcggcggtcaaaggcgttccggaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system