KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0265Help
Entry
NMB0265           CDS       T00027                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMB0265 (ruvA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NMB0265 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(269389..269973)
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELARAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAAPAADETEDIVSTLLALGYSEREAKAAVKGVPEGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaggccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaagaccttccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcaatgactgccgacgaactggcgcgg
gcggttgcagaagaagatgtcaaacgcctctcctccgccccgggaatcggcaaaaaaacc
gccgaacgtatggttttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacagcgaacgcgaagcaaaagcggcggtcaaaggcgttccggaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system