KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0284Help
Entry
NMB0284           CDS       T00027                                 

Gene name
purB
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0284 (purB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0284 (purB)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     NMB0284 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
291263..292633
Genome map
AA seq 456 aa AA seqDB search
MINPIASLSPLDGRYAQSVEALRPIFSEYGLMKARVKVELNWLKALAAEPKIAEVPPFSA
ETLAEIDTVIENFSLEDAAAVKAIEATTNHDVKAIEYWLKKRFAEVPEVAAVSEFIHFAC
TSEDINNLSHALMLQEAREAVLLPKLAEIIEKLTAMAHDLAAVPMMSRTHGQPATPTTLG
KETANVVYRLQRQFKNLQAQEFLGKINGAVGNYNAHMVAYPDVDWETHCRNFVEISLGLT
FNPYTIQIEPHDYMAEFFQTLSRINTILIDFNRDVWGYISLGYFKQKVKAGEVGSSTMPH
KVNPIDFENSEGNLGMANAVLGFLSEKLPISRWQRDLTDSTVLRNMGVGVGYAVLGFAAH
LRGLNKLEPNPAALAADLDATWELLAEPIQTVMRRYGVANPYEKLKDLTRGKGGITPEVL
KGFIGLLEIPAEAKAKLLELTPALYVGKAEALAKRI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaccccatcgcctcgctttcccctttagatggccgttatgcccaatccgttgaa
gcattgcgcccgattttttccgaatacggcctgatgaaggcgcgcgtcaaagtcgaatta
aactggctcaaagccctcgccgccgagccgaagattgccgaagtgccgcccttcagtgcc
gaaacgcttgccgaaatcgacacggtgattgaaaacttttcattggaagacgcggccgcc
gtcaaagccatcgaagccaccaccaatcacgatgtcaaagccatcgaatattggctgaaa
aaacgttttgccgaagtgccggaagtcgccgccgtgagtgagttcatccacttcgcctgc
accagcgaagacatcaacaacctgtcccacgctttaatgctgcaagaagcgcgtgaggct
gttttgctgccgaagctggccgaaatcatcgaaaaactgaccgctatggcgcacgacctt
gccgccgtcccgatgatgagccgcacccacggccagcccgccacgccgaccactttgggc
aaagaaaccgccaatgtcgtgtaccgcctgcaacgccagtttaaaaacctgcaagcgcaa
gagttcctcggcaaaatcaacggcgcggtcggcaactacaacgcccatatggtcgcctat
cctgatgtagattgggaaacccactgccgcaacttcgtcgaaatcagcctcggtctgacc
ttcaacccctacaccatccaaatcgaaccgcacgactatatggcggaattcttccaaacc
ctcagccgcatcaacacgattctcatcgactttaaccgcgacgtttggggttatatttca
ttgggttacttcaaacaaaaagtcaaagcaggcgaagtcggttcttccaccatgccgcac
aaagtcaaccccatcgactttgaaaactccgagggcaacctcggtatggcaaacgccgta
ttgggctttttgtccgaaaaactgccgatttcccgctggcagcgcgacctgaccgacagc
accgtattgcgcaatatgggcgtaggcgtgggctatgccgtattgggtttcgccgcccac
ctgcgcggtctgaacaagctcgaacccaaccccgccgcgcttgccgccgatttggatgcc
acttgggagctgctcgccgagccgattcaaaccgtaatgcgccgttacggtgtcgccaat
ccttacgaaaaactgaaagacctgacgcgcggcaaaggcggcatcacgcccgaagtgctg
aaaggctttatcggattgctggaaatccccgccgaagccaaagccaaattgcttgagctg
acccccgcgctgtatgtgggcaaggctgaagcgttggcgaaacggatttga

DBGET integrated database retrieval system