KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0307Help
Entry
NMB0307           CDS       T00027                                 

Gene name
aroG
Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0307 (aroG)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0307 (aroG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB0307 (aroG)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     NMB0307 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
316410..317465
Genome map
AA seq 351 aa AA seqDB search
MTHHYPTDDIKIKEVKELLPPIAHLYELPISKEASGLVHRTRQEISDLVHGRDKRLLVII
GPCSIHDPKAALEYAERLLKLRKQYENELLIVMRVYFEKPRTTVGWKGLINDPHLDGTFD
INFGLRQARSLLLSLNNMGMPASTEFLDMITPQYYADLISWGAIGARTTESQVHRELASG
LSCPVGFKNGTDGNLKIAIDAIGAASHSHHFLSVTKAGHSAIVHTGGNPDCHVILRGGKE
PNYDAEHVSEAAEQLRAAGVTDKLMIDCSHANSRKDYTRQMEVAQDIAAQLEQDGGNIMG
VMVESHLVEGRQDKPEVYGKSITDACIGWGATEELLALLAGANKKRMARAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccattaccccacagacgatattaagattaaagaagttaaagagttgttgccg
ccgatagcccatctttacgagctgccgatttccaaagaggcttcgggcttggttcaccgc
acccgtcaggaaatttccgatttggttcacggcagggacaagcggctgttggttattatc
gggccgtgttcgattcacgatccgaaagcggcgttggaatatgcggagcgtttgttgaaa
ctccgcaagcagtatgaaaacgagcttttgattgtgatgcgcgtttatttcgagaagccg
aggacgacggtgggttggaaaggtttgattaacgacccgcatttggacggtacgtttgac
atcaatttcggtttgcgtcaggcgcgcagcctgttgttgtcgctgaacaatatgggtatg
cctgcctctaccgagtttttggatatgattacgccgcaatattatgcggacttgatttct
tggggggcaatcggtgcgcggacgaccgaaagccaagttcaccgcgaattggcaagcggg
ctgtcctgccccgtcggctttaaaaacggtacggacggcaatttgaagattgccatcgac
gcaatcggtgcggcgagccattcgcatcatttcctgtctgtaaccaaggccgggcattcc
gccattgtccataccggcggcaatcccgactgtcatgtcattttgcgcggcggcaaagag
ccgaattatgatgcggaacacgtcagcgaggcggcggaacaactgcgtgcggcaggggta
accgacaagctgatgatagattgcagccacgccaacagccgcaaggattacactcggcag
atggaagtggcacaagacattgccgcccaattggaacaggacggcggcaatatcatgggc
gtgatggtggaaagccatttggtcgaaggcagacaggacaagccggaagtgtacggcaag
agcattaccgatgcgtgtatcggttggggcgcgactgaagaactgttggcattgttggca
ggtgcaaacaaaaaacgtatggcgcgcgccagttga

DBGET integrated database retrieval system