KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0319Help
Entry
NMB0319           CDS       T00027                                 

Gene name
farB
Definition
(RefSeq) fatty acid efflux system protein
  KO
K03446  
MFS transporter, DHA2 family, multidrug resistance protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    NMB0319 (farB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
330791..332317
Genome map
AA seq 508 aa AA seqDB search
MDYPPLKGAALAWVTLSLGLAVFMEVLDTTIANVAVPVIAGNLGAATTQGTWVITSFSVA
NAVSVPLTGFLAKRIGEVKLFTAAAVGFVITSWLCGIAPNLQSLVVFRILQGFIAGPLIP
LSQSLLMASYPPAKRTLALALWAMTVVVAPVLGPILGGWISGNWHWGWIFFINIPIGIIS
AWITWKHLKYRETETVKMPTDYVGLTLMVVGIGALQMMLDRGKELDWFASGEIITLGVVA
LVCLSYFIVWELGEKYPIVDLSLFKDRNFTVGVIATSLGFMVYMGTLTLLPLVLQTNLGY
TSTWAGLAAAPVGILPVFLSPLIGRFGNKIDMRLFVTASFLTFAFTFYWRTDFYADMDIG
NVIWPQFWQGVGVAMFFLPLTTITLSHMKGGQIAAAGSLSNFLRVLMGGVGVSVVSTLWE
RREALHHTRFAEHITPYSATLHETAAHLSQHGVSDIQTLGIINNTITQQGFIIGSNEIFM
AGSLLFIIMIPVIWLAKPPFHNGGGGGH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggattatccaccgcttaagggtgcggcattggcgtgggttacgctgtctttggggctt
gccgtatttatggaagttttagatacgactatcgccaatgtcgccgttcccgtcatcgcc
ggcaacctcggtgcggcaaccactcaggggacgtgggtcatcacttccttttctgtggca
aacgccgtttccgtgccgctgacgggctttttggcaaaacgcatcggcgaggtcaaattg
tttaccgccgccgctgtcggtttcgtcatcacatcgtggctgtgcggtattgcccccaac
cttcagtcgctggttgttttccgcatcttgcagggctttatcgccgggccgctgattccc
ttgtcgcaaagcctgttaatggcatcctatccgcccgcaaaacggacgctggcactggca
ttgtgggcaatgaccgtcgttgtcgcccctgttctcgggccgatactcggcggctggatt
tccggaaactggcattggggttggattttcttcattaatatccctatcggtatcatatcg
gcatggattacatggaaacatttgaaatatcgggaaacggaaaccgttaaaatgccgacc
gactatgtcgggcttacattgatggtagtcggtatcggcgcgttacagatgatgctggac
aggggtaaggaactcgactggttcgcctctggagaaatcattaccttgggcgtagtcgca
ctggtgtgcttgtcgtattttattgtttgggaattgggagaaaaatatccgattgtcgat
ttatcgctgtttaaagatcggaattttaccgtcggcgtcattgccacgtcattgggtttt
atggtgtatatggggacgctgaccctgctgccgttagtgttgcagaccaacctgggctat
acctccacgtgggcagggcttgccgccgcacctgtcggcatcctgcctgttttcctgtct
ccgttaatcggcaggttcggcaataaaatcgatatgcgcctgttcgtaactgccagcttc
ctgacctttgcctttactttctattggcgtacggatttttatgccgatatggatattggc
aacgtcatctggccgcagttttggcagggtgtcggtgtcgccatgttttttctgccgctg
accaccatcacactgtcgcatatgaagggcgggcagattgccgccgcaggcagcctgtcg
aatttcttgcgcgtgctgatgggcggtgtcggcgtatccgtcgtcagcaccctgtgggaa
cggcgcgaagcgttgcaccacacacgctttgccgaacacatcacgccctattccgcaaca
ttgcacgaaacggccgctcatttgtcccagcacggcgtttccgacattcaaaccctaggc
atcatcaacaataccattacccagcagggttttattatcggctcgaacgaaatctttatg
gcgggcagcttgttattcattatcatgatacccgtcatatggctggcaaaaccgccgttc
cacaacggcggcggcggtggacattga

DBGET integrated database retrieval system