KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0326Help
Entry
NMB0326           CDS       T00027                                 

Gene name
ispB
Definition
(RefSeq) octaprenyl-diphosphate synthase
  KO
K02523  
octaprenyl-diphosphate synthase [EC:2.5.1.90]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0326 (ispB)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.90  all-trans-octaprenyl-diphosphate synthase
     NMB0326 (ispB)
Prenyltransferases [BR:nme01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NMB0326 (ispB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
335528..336502
Genome map
AA seq 324 aa AA seqDB search
MLENLPYFQRHLPEDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKA
VGYDDEKLYSLAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTR
AFQLMVASGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAA
AQVGAILGKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTL
PLIYLMRQGSEQVANDVRTALENADRSYFEKIHDYVVRSDALAYSIGEARKAVDCAVTAL
DALPDSEVKDAMIQLAKESLVRVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagaatctgccctatttccagcgacatctgcctgaagaccttgccaaagtcaat
gaagtcatcaaccgtgcggtgcaatccgatgtcgcactgatttcgcaaatcggtacatat
atcatcagcgcgggcggcaaacgcctgcgtccgattatgacgattttggcgggtaaggcg
gtcggttatgatgacgagaaactgtattcgctggcggcgatggtcgagtttatccacact
tccaccctcctgcacgacgatgtcgtcgatgaaagcgatttgcgccgtgggcgggcaacg
gcaaacaatctgttcggcaatgcggcggctgtgttggttggcgactttttatacacgcgc
gcctttcaactgatggttgcctcgggcagtatgcgcgttttggaagtgatggcggatgca
accaacattattgccgagggcgaagtcatgcagctgatgaacatcggcaatacggacatt
accgaagaacaatatatccaagtcatccaatataaaacggcaaaattgtttgaagctgcc
gctcaagtcggcgcaattttgggcaaggcttcccccgaacacgaacgggcgttgaaagac
tacggtatgtatgtcggtacggcattccaaattattgacgatgtgctggactattctggc
gaaaccgaagaaaccggcaaaaacgtcggcgacgatttggcggaaggaaaaccgactttg
cctttgatttatctgatgcgtcagggttccgaacaggttgcgaacgatgtgcgtactgct
ttggaaaatgcagatcgcagctattttgagaaaatccacgattatgtcgtccgttcggat
gcgttggcatattcgataggcgaggcgcgcaaagcagtcgattgtgccgttaccgccttg
gatgccctgcccgacagcgaagtgaaggatgccatgattcagctggcgaaggaatctttg
gtcagggtgtcttga

DBGET integrated database retrieval system