KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0331Help
Entry
NMB0331           CDS       T00027                                 

Definition
(RefSeq) kinase
  KO
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0331
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     NMB0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(339358..339990)
Genome map
AA seq 210 aa AA seqDB search
MTVWVGLTGGIGSGKSAAAQCFADLGVPRIDADAAAHSLTASDGIALPEIRRLFGDTVFD
TQGLLRRDILRKEVFASPSRKALLESVMLPLIFSEIKKQQETFTDAAYGIVEIPLLTEKR
QFISLIRRVLTISAPVEKRIGRVMARSGLTRGEVAAVISHQASESERLLLADDVLLNDGS
LKSLREKTMRLHAFYSGIFASKPTQGKHND
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacggtatgggtcggactgaccggcggaatcggcagcggcaaatcggcagccgcgcaa
tgttttgccgatttgggcgtgccgcgcatcgatgcagacgcggcggcgcactcgctgacg
gcttcagacggcatcgccctgccggaaatcaggcggctgttcggcgacaccgtttttgac
acacagggtttgttgcggcgcgacatattgcgtaaagaagtctttgcctccccatcgcga
aaagccttgctcgaatccgtgatgttgccgctgattttctcagaaatcaaaaaacagcaa
gaaacctttactgatgcagcttacggcattgtcgaaattccgctgctgacggaaaagcgt
caatttatcagcctgatacggcgtgtcctgaccataagtgcccctgtggaaaaacgtatc
ggcagggtgatggcccgcagcgggctgacgcgcggcgaggtggcggccgtcatcagccat
caggcatccgaatccgaacgcctgctgcttgcagacgatgtgctgctcaatgacggcagc
ctcaaaagcctgcgtgagaaaacaatgcgcctgcacgcgttttattcagggattttcgcc
tcaaaaccaacacaaggaaaacacaatgactga

DBGET integrated database retrieval system