KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0336Help
Entry
NMB0336           CDS       T00027                                 

Gene name
fabI
Definition
(RefSeq) enoyl-(acyl carrier protein) reductase
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NMB0336 (fabI)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB0336 (fabI)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0336 (fabI)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    NMB0336 (fabI)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NMB0336 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NMB0336 (fabI)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB0336 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
345344..346129
Genome map
AA seq 261 aa AA seqDB search
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgcaaggcaaaaaaattctgattaccggcatgatttccgagcgttccatc
gcttacggcatcgccaaagcctgccgcgaacaaggcgcggaactggcgtttacctacgtt
gtggacaaactggaagagcgcgtccgcaaaatggcggcggaattggattccgaacttgta
ttccgctgcgatgtcgccagcgacgacgaaatcaaccaagtgttcgccgacttgggcaaa
cattgggacggcttggacggtttggtgcattccatcggttttgcgccgaaagaagccttg
agcggcgacttcctcgacagcatcagccgcgaagcgttcaacaccgcacacgaaatttcc
gcatacagcctgcccgcgttggcaaaagccgcccgtccgatgatgcgcggcagaaattcc
gccatcgtcgccctgagctacttgggcgcggtgcgcgcgattccgaattacaacgtgatg
ggtatggcaaaagccagccttgaggcaggcatccgctttaccgctgcctgtctgggtaaa
gagggcatccgctgcaacggtatttccgccggcccgattaaaacgcttgccgcctccggc
atcgccgatttcggcaaactcttgggacacgtcgccgcccacaacccgctccgccgcaac
gttaccattgaagaagtcggcaataccgccgccttcctgctgtccgacctgtcgtccggc
attaccggcgaaatcacttacgttgacggcggttacagcattaatgccttgagcaccgag
ggataa

DBGET integrated database retrieval system