KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0336Help
Entry
NMB0336           CDS       T00027                                 

Gene name
fabI
Definition
(RefSeq) enoyl-(acyl carrier protein) reductase
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB0336 (fabI)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0336 (fabI)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    NMB0336 (fabI)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NMB0336 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NMB0336 (fabI)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB0336 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
345344..346129
Genome map
AA seq 261 aa AA seqDB search
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgcaaggcaaaaaaattctgattaccggcatgatttccgagcgttccatc
gcttacggcatcgccaaagcctgccgcgaacaaggcgcggaactggcgtttacctacgtt
gtggacaaactggaagagcgcgtccgcaaaatggcggcggaattggattccgaacttgta
ttccgctgcgatgtcgccagcgacgacgaaatcaaccaagtgttcgccgacttgggcaaa
cattgggacggcttggacggtttggtgcattccatcggttttgcgccgaaagaagccttg
agcggcgacttcctcgacagcatcagccgcgaagcgttcaacaccgcacacgaaatttcc
gcatacagcctgcccgcgttggcaaaagccgcccgtccgatgatgcgcggcagaaattcc
gccatcgtcgccctgagctacttgggcgcggtgcgcgcgattccgaattacaacgtgatg
ggtatggcaaaagccagccttgaggcaggcatccgctttaccgctgcctgtctgggtaaa
gagggcatccgctgcaacggtatttccgccggcccgattaaaacgcttgccgcctccggc
atcgccgatttcggcaaactcttgggacacgtcgccgcccacaacccgctccgccgcaac
gttaccattgaagaagtcggcaataccgccgccttcctgctgtccgacctgtcgtccggc
attaccggcgaaatcacttacgttgacggcggttacagcattaatgccttgagcaccgag
ggataa

DBGET integrated database retrieval system