KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0337Help
Entry
NMB0337           CDS       T00027                                 

Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB0337
   01230 Biosynthesis of amino acids
    NMB0337
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0337
   00280 Valine, leucine and isoleucine degradation
    NMB0337
   00290 Valine, leucine and isoleucine biosynthesis
    NMB0337
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB0337
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     NMB0337
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class IV
   NMB0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(346373..347371)
Genome map
AA seq 332 aa AA seqDB search
MSRPVPAVFGSVFHSQMPVLAYREGKWQPTEWQSSQDLSLAPGAHALHYGSECFEGLKAF
RQADGKIVLFRPTANIARMRQSADILHLPRPETEAYLDALIKLVKRAADEIPDAPAALYL
RPTLIGTDPVIGKAGSPSETALLYILASPVGDYFKVGSPVKILVETEHIRCAPHMGRVKC
GGNYASAMHWVLKAKAEYGANQVLFCPNGDVQETGASNFILINGDEIITKPLTDEFLHGV
TRDSVLTVAKDLGYTVSERNFTVDELKAAVENGAEAILTGTAAVISPVTSFVIGGKEIEV
KSQERGYAIRKAITDIQYGLAEDKYGWLVEVC
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacccgtacccgccgtattcggcagcgtttttcacagtcaaatgcccgtcctc
gcctaccgcgaaggcaaatggcagccgaccgaatggcaatcttcccaagacctctccctc
gcaccgggcgcgcacgccctgcactacggcagcgaatgtttcgagggactgaaagccttc
cgtcaggcagacggcaaaatcgtgctgttccgtccgactgccaatatcgcgcgtatgcgg
caaagtgcggacattttgcacctgccgcgccccgaaaccgaagcttatcttgacgcgcta
atcaaattggtcaaacgtgccgccgatgaaattcccgatgcgcctgccgccctgtacctg
cgtccgaccttaatcggtaccgatcccgttatcggcaaggccggttctccttccgaaacc
gccctgctgtatattttggcttcccccgtcggcgactatttcaaagtcggatcgcccgtc
aaaattttggtggaaaccgaacacatccgctgcgccccgcatatgggccgcgtcaaatgc
ggcggcaactacgcttccgccatgcactgggtgctgaaggcgaaagccgaatatggcgca
aatcaagtcctgttctgcccgaacggcgacgtgcaggaaaccggcgcgtccaactttatc
ctgattaacggcgatgaaatcattaccaaaccgctgaccgacgagtttttgcacggcgta
acccgcgattccgtactgacggttgccaaagatttgggctataccgtcagcgaacgcaat
ttcacggttgacgaactcaaagctgcggtggaaaacggtgcggaagccattttgaccggt
acggcagccgtcatctcgcccgttacttccttcgtcatcggcggcaaagaaatcgaagtg
aaaagccaagaacgcggctatgccatccgtaaggcgattaccgacatccagtatggtttg
gcggaagacaaatacggctggctggttgaagtgtgctga

DBGET integrated database retrieval system