KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0340Help
Entry
NMB0340           CDS       T00027                                 

Gene name
gloA
Definition
(RefSeq) lactoylglutathione lyase
  KO
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0340 (gloA)
Enzymes [BR:nme01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     NMB0340 (gloA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
349200..349616
Genome map
AA seq 138 aa AA seqDB search
MRLLHTMLRVGNLEKSLDFYQNVLGMKLLRRKDYPEGRFTLAFVGYGDETDSTVLELTHN
WDTERYDLGNAYGHIAVEVDDAYEACERVKRQGGNVVREAGPMKHGTTVIAFVEDPDGYK
IEFIQKKSGDDSVAYQTA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttactccatactatgctccgcgtgggcaatctcgaaaaatccctcgatttctac
caaaacgttttgggtatgaaactgctccgccgaaaagattatcccgaaggcagatttacc
cttgccttcgtcggttacggcgatgaaaccgacagcacggttttggaactgacgcacaac
tgggatacggaacgatacgacttgggcaacgcctacggacacatcgcggttgaagtggac
gatgcctacgaagcctgcgaacgtgtgaagcggcagggcggaaacgtcgtccgcgaagcc
ggcccgatgaaacacggcacaaccgtgatagccttcgtcgaagaccccgacggatacaaa
atcgagttcattcaaaagaaaagcggcgacgattcggttgcctatcaaactgcctga

DBGET integrated database retrieval system