KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0351Help
Entry
NMB0351           CDS       T00027                                 

Gene name
tal
Definition
(RefSeq) transaldolase
  KO
K00616  
transaldolase [EC:2.2.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0351 (tal)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     NMB0351 (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(358919..359974)
Genome map
AA seq 351 aa AA seqDB search
MTILSDVKALGQQIWLDNLSRSLVQSGELAQMLKQGVCGVTSNPAIFQKAFAGDALYADE
IAALKQQNLSPKQRYETMAVADVRAACDVCLAEHESTGGKTGFVSLEVSPELSKDAQGTV
EEARRLYAAIGCKNAMIKVPATDAGIDALETLVSDGISVNLTLLFSRAQTLKAYAAYARG
IAKRLAAGQSVAHIQVVASFFISRVDGALDTTLPDHLKGKIAIALAKAAYQDWAQYFGSP
EFAALETKGANRVQLLWASTGVKNPAYPDTLYVDSLIGAHTVNTVPDATLKAFIDHGTAK
ATLTEGVEEAQAQLAETAALGIDVETLATRLQEDGLKQFEEAFEKLLAPLA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttatcggacgttaaagcattaggacaacaaatctggctggacaacctttcc
cgctcgctagtgcaaagcggcgaattggcgcaaatgttgaaacagggcgtgtgcggcgta
acttccaatcccgccatcttccaaaaagccttcgccggcgacgcgctttacgccgatgaa
atcgccgccctcaagcagcaaaacctcagccccaaacaacgctacgaaacaatggcggtt
gccgatgtgcgtgccgcctgcgacgtttgccttgccgaacacgaatccaccggcggcaaa
accggcttcgtcagcctcgaagtttcgcccgaattgtccaaagacgcgcaaggcacggtt
gaagaagcgcgccgcctctacgccgccatcgggtgcaaaaacgcgatgattaaagtgcct
gccaccgacgcaggcatcgatgcgctcgaaaccctcgtttcagacggcatcagcgtgaac
ctgaccctgctgttctcacgcgcccaaaccctcaaagcctacgccgcctacgcgcgcggc
atcgccaaacgcttagcagccggacaaagcgttgcccatatccaagttgtcgccagcttc
ttcatctcccgtgtggacggcgcgctggacacaacactgcccgaccacctcaaaggcaaa
atcgccatcgcccttgccaaagccgcctaccaagactgggcgcaatacttcggcagcccc
gaatttgccgcgctggaaaccaaaggcgcaaaccgcgtgcagcttttatgggcatctacc
ggcgtgaaaaacccggcctatcccgacacgctctacgttgacagcctgatcggcgcgcac
accgtcaacaccgttcccgatgccacgctcaaagcctttatcgaccacggcacagccaaa
gccacgctgaccgaaggcgtagaagaagcacaagcgcagctcgccgaaaccgccgcgctc
ggcatcgatgtcgaaaccttggcaacgcgtttgcaggaagacggtttgaaacagtttgaa
gaagcgtttgaaaaactgctcgcgcctttggcttag

DBGET integrated database retrieval system