KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0352Help
Entry
NMB0352           CDS       T00027                                 

Definition
(RefSeq) KpsF/GutQ family sugar isomerase
  KO
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0352
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.13  arabinose-5-phosphate isomerase
     NMB0352
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
360071..361045
Genome map
AA seq 324 aa AA seqDB search
MAENGKYLDWAREVLHAEAEGLREIAAELDKNFVLAADALLHCKGRVVITGMGKSGHIGR
KMAATMASTGTPAFFVHPAEAAHGDLGMIVDNDVVVAISNSGESDEIAAIIPALKRKDIT
LVCITARPDSTMARHADIHITASVSKEACPLGLAPTTSTTAVMALGDALAVVLLRARAFT
PDDFALSHPAGSLGKRLLLRVADIMHKGGGLPAVRLGTPLKEAIVSMSEKGLGMLAVTDG
QGRLKGVFTDGDLRRLFQECDNFTGLSIDEVMHTHPKTISAERLATEALKVMQANHVNGL
LVTDADGVLIGALNMHDLLAARIV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacggaaaatatctcgactgggcacgcgaagtgttgcacgccgaagcggaa
ggcttgcgcgaaattgcagcggaattggacaaaaacttcgtccttgcggcagacgcgttg
ttgcactgcaagggcagggtcgttatcacgggcatgggcaagtcgggacatatcgggcgc
aaaatggcggcaactatggcctcgaccggcacgcctgcgtttttcgtccaccctgcggaa
gcggcacacggcgatttgggtatgattgtggacaacgacgtggtcgtcgcgatttccaat
tccggcgaaagcgacgaaatcgccgccatcatccccgcactcaaacgcaaagacatcacg
cttgtctgcatcaccgcccgccccgattcaaccatggcgcgccatgccgacatccacatc
acggcgtcggtttccaaagaagcctgcccgctggggcttgccccgaccaccagcaccacc
gccgtcatggctttgggcgatgcgttggcggtcgtcctgctgcgcgcacgcgcgttcacg
cccgacgatttcgccttgagccatcctgccggcagcctcggcaaacgcctacttttgcgc
gttgccgacattatgcacaaaggcggcggcctgcctgccgtccgactcggcacgcccttg
aaagaagccatcgtcagcatgagtgaaaaagggctgggcatgttggcggtaacggacggg
caaggccgtctgaaaggcgtattcaccgacggcgatttgcgccgcctgtttcaagaatgc
gacaattttaccggtctttcgatagacgaagtcatgcatacgcatcctaaaaccatctcc
gccgaacgtctcgccaccgaagccctgaaagtcatgcaggcaaaccatgtgaacgggctt
ctggttaccgatgcagatggcgtgctgatcggcgcgctgaatatgcacgacctgctggcg
gcacggattgtatag

DBGET integrated database retrieval system