KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0358Help
Entry
NMB0358           CDS       T00027                                 

Gene name
aroE
Definition
(RefSeq) shikimate dehydrogenase
  KO
K00014  
shikimate dehydrogenase [EC:1.1.1.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0358 (aroE)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0358 (aroE)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     NMB0358 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(364869..365678)
Genome map
AA seq 269 aa AA seqDB search
MTALPRYAVFGNPVAHSKSPQIHQQFALQEGVDIEYERICADIGGFAQAVSTFFETGGCG
ANVTVPFKQEAFHLADEHSERALAAGAVNTLIPLKNGKLRGDNTDGIGLTNDITQVKNIA
IEGKTILLLGAGGAVRGVIPVLKEHRPARIVIANRTRAKAEELAQLFGIEAVPMADVNGG
FDIIINGTSGGLNGQIPDIPPDIFQNCALAYDMVYGCAAKPFLDFARQSGAKKTADGLGM
LVGQAAASYALWRGFTPDIRPVIEYMKAL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctcccccgctacgccgttttcggcaaccccgtcgcccacagcaaatcgccg
caaattcatcaacaatttgcccttcaggaaggcgttgacattgaatacgaacgcatttgc
gccgacatcggcggtttcgcgcaggcggtttcgacattttttgaaacaggcggttgcggg
gcaaacgttaccgtaccgttcaaacaggaagcgtttcatctggcggacgagcattccgaa
cgcgcattggcggcaggtgcggtcaatacgctgattccgttgaaaaacggcaagctgcgt
ggcgacaacaccgacggtatcggtttgaccaacgacatcacgcaggtcaaaaatattgcc
atcgagggcaaaaccattttgcttttgggcgcaggcggcgcggtgcgcggcgtgattcct
gttttgaaagaacaccgtcctgcccgtatcgtcattgccaaccgtacccgcgccaaagcc
gaggaattggcgcagcttttcggcattgaagccgtcccgatggcggacgtgaacggcggt
tttgatatcatcatcaacggcacgtcgggcggtctaaacggtcagattcccgatattccg
cccgatatttttcaaaactgcgcgcttgcctacgatatggtgtacggctgcgcggcaaaa
ccgtttttagattttgcacgacaatcgggtgcgaaaaaaactgccgacggactgggtatg
ctagtcggtcaagcggcggcttcctacgccctctggcgcggatttacgcccgatatccgc
cccgttatcgaatacatgaaagccctataa

DBGET integrated database retrieval system