KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0359Help
Entry
NMB0359           CDS       T00027                                 

Gene name
glnA
Definition
(RefSeq) glutamine synthetase
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB0359 (glnA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0359 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    NMB0359 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0359 (glnA)
   00220 Arginine biosynthesis
    NMB0359 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NMB0359 (glnA)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     NMB0359 (glnA)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB0359 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
365978..367396
Genome map
AA seq 472 aa AA seqDB search
MSIKNAVKLIEESEARFVDLRFTDTKGKQHHFTVPARIVLEDPEEWFENGQAFDGSSIGG
WKGIQASDMQLRPDASTAFVDPFYDDATVVLTCDVIDPADGQGYDRDPRSIARRAEAYLK
SSGIGETAYFGPEPEFFVFDGIEFETDMHKTRYEITSESGAWASGLHMDGQNTGHRPTVK
GGYAPVAPIDCGQDLRSAMVNILEELGIEVEVHHSEVGTGSQMEIGTRFATLVKRADQTQ
DMKYVIQNVAHNFGKTATFMPKPIMGDNGSGMHVHQSIWKDGQNLFAGDGYAGLSDTALY
YIGGIIKHAKALNAITNPSTNSYKRLVPHFEAPTKLAYSAKNRSASIRIPSVNSSKARRI
EARFPDPTANPYLAFAALLMAGLDGIQNKIHPGDPADKNLYDLPPEEDALVPTVCASLEE
ALAALKADHEFLLRGGVFSKDWIDSYIAFKEEDVRRIRMAPHPLEFEMYYSL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctattaaaaacgccgtaaaattgattgaagaaagcgaagcccgctttgtcgatttg
cgctttaccgataccaaaggcaagcagcaccactttaccgtgcctgcgcgcatcgtgttg
gaagaccccgaagagtggttcgaaaacggtcaggcgtttgacggttcgtctatcggcggc
tggaaaggcattcaggcttccgatatgcagttgcgccccgatgcgtctacagccttcgtc
gatcctttttatgatgatgcgactgttgtgttgacttgcgacgttatcgatcccgccgac
ggtcagggttacgaccgcgacccgcgctccatcgcccgccgagccgaagcctatttgaaa
tcttccggcatcggcgagaccgcctatttcggtcccgaacccgagtttttcgtattcgac
ggcatagaatttgaaaccgatatgcacaaaacccgttacgaaatcacgtccgaaagcggc
gcgtgggcaagcggtctgcatatggacggtcaaaacaccggccaccgcccgaccgtcaaa
ggcggttacgcacctgttgcaccgattgactgcggtcaggatttgcgttcggcgatggta
aacattttggaagaactcggtattgaagtggaagtgcaccacagcgaagtcggcaccggc
agccaaatggaaatcggcacgcgctttgctactttggtcaaacgcgccgaccaaacccaa
gacatgaaatatgtgattcaaaacgttgcccacaacttcggcaaaaccgccactttcatg
cccaaacccattatgggcgacaacggcagcggtatgcacgttcaccaatccatttggaaa
gacggtcaaaacctgttcgcaggcgacggctatgccggcttgagcgacaccgcgctctac
tacatcggcggcatcatcaaacacgccaaagccttgaacgcgattaccaatccgtccacc
aactcctacaaacgcctcgtgccgcactttgaagcgccgaccaaactggcatactccgcc
aaaaaccgttccgcttccatccgcattccgtccgtgaacagcagcaaggcgcgccgcatc
gaagcgcgtttccccgatccgaccgccaacccgtatttggcatttgccgccctgttgatg
gcgggtttggacggcattcaaaacaaaatccatccgggcgaccctgccgataaaaacctg
tacgatctgccgccggaagaagatgcattggtgccgaccgtttgcgcttctttggaagaa
gcactggccgccctcaaagccgaccacgaattcctcctgcgcggcggcgtgttcagcaaa
gactggatcgacagctacatcgctttcaaagaagaagacgtacgccgcatccgcatggcg
ccgcacccgctggaatttgaaatgtattacagcctgtaa

DBGET integrated database retrieval system