KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0377Help
Entry
NMB0377           CDS       T00027                                 

Gene name
anmK
Definition
(RefSeq) anhydro-N-acetylmuramic acid kinase
  KO
K09001  
anhydro-N-acetylmuramic acid kinase [EC:2.7.1.170]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.170  anhydro-N-acetylmuramic acid kinase
     NMB0377 (anmK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(378394..379524)
Genome map
AA seq 376 aa AA seqDB search
MAFCTSLGVMMETQLYIGIMSGTSMDGADAVLIRMDGGKWLGAEGHAFTPYPGRLRRQLL
DLQDTGADELHRSRILSQELSRLYAQTAAELLCSQNLAPSDITALGCHGQTVRHAPEHGY
SIQLADLPLLAERTRIFTVGDFRSRDLAAGGQGAPLVPAFHEALFRDNRETRAVLNIGGI
ANISVLPPDAPAFGFDTGPGNMLMDAWTQAHWQLPYDKNGAKAAQGNILPQLLDRLLAHP
YFAQPHPKSTGRELFALNWLETYLDGGENRYDVLRTLSRFTAQTVCDAVSHAAADARQMY
ICGGGIRNPVLMADLAECFGTRVSLHSTADLNLDPQWVEAAAFAWLAACWINRIPGSPHK
ATGASKPCILGAGYYY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttgcaccagtttgggagtgatgatggaaacacagctttacatcggcatcatg
tcgggaaccagcatggacggggcggatgccgtactgatacggatggacggcggcaaatgg
ctgggcgcggaagggcacgcctttaccccctaccccggcaggttacgccgccaattgctg
gatttgcaggacacaggcgcagacgaactgcaccgcagcaggattttgtcgcaagaactc
agccgcctatatgcgcaaaccgccgccgaactgctgtgcagtcaaaacctcgcaccgtcc
gacattaccgccctcggctgccacgggcaaaccgtccgacacgcgccggaacacggttac
agcatacagcttgccgatttgccgctgctggcggaacggacgcggatttttaccgtcggc
gacttccgcagccgcgaccttgcggccggcggacaaggcgcgccactcgtccccgccttt
cacgaagccctgttccgcgacaacagggaaacacgcgcggtactgaacatcggcgggatt
gccaacatcagcgtactcccccccgacgcacccgccttcggcttcgacacagggccgggc
aatatgctgatggacgcgtggacgcaggcacactggcagcttccttacgacaaaaacggt
gcaaaggcggcacaaggcaacatattgccgcaactgctcgacaggctgctcgcccacccg
tatttcgcacaaccccaccctaaaagcacggggcgcgaactgtttgccctaaattggctc
gaaacctaccttgacggcggcgaaaaccgatacgacgtattgcggacgctttcccgtttt
accgcgcaaaccgtttgcgacgccgtctcacacgcagcggcagatgcccgtcaaatgtac
atttgcggcggcggcatccgcaatcctgttttaatggcggatttggcagaatgtttcggc
acacgcgtttccctgcacagcaccgccgacctgaacctcgatccgcaatgggtggaagcc
gccgcatttgcgtggttggcggcgtgttggattaatcgcattcccggtagtccgcacaaa
gcaaccggcgcatccaaaccgtgtattctgggcgcgggatattattattga

DBGET integrated database retrieval system