KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0378Help
Entry
NMB0378           CDS       T00027                                 

Definition
(RefSeq) phosphate permease
  KO
K03306  
inorganic phosphate transporter, PiT family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
379815..381389
Genome map
AA seq 524 aa AA seqDB search
MAQIQMSANVKTINAVFAAMLVGTVGYFIYWGLGYTHYNYAALFIIATMFGVFMAFNIGG
NDVANSFGTSVGAGTLTIPQALLIAAVFEVSGAVIAGGEVTNTIRKGIVDLKGVDFEPIQ
FVFIMMSALLAAALWLLFASKKGLPVSTTHSIIGGIVGSAVCMAVMNDAASGDLIRWGKL
GGIGVSWVLSPVLGGAVSYFLFSRVKKNVLDYNAWAEGTLKGIKQEKKAYKERHRLFFEG
LSEAEKVEYATKMAHDAQIYDEPEFDPQELQSEYYRGLYAFDNRKNNVDSYKALHSWIPF
IASFGAMMISAMLIFKGLKNLHLGMSNVNSFLTIFMIGAAVWMGTFVFAKSLKRKDLGKS
TFQMFSWMQVFTACGFAFSHGANDIANAIGPFAAIMDVLRTNSVAAQNVVPPIAMLTFGI
ALIVGLWFVGKEVIKTVGTSLAEMHPASGFTAELSAASVVMGASLMGLPVSSTHILVGAV
LGIGLVNRNANWKLMKPIGLAWVITLPAAAVLSVVCYLVLQAVF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatccaaatgagcgcaaatgttaaaaccatcaacgccgtctttgccgccatg
ctggtaggtacagtcggctattttatttattggggcttgggttatacccattacaattac
gccgccttattcattattgccacgatgttcggcgtgtttatggcgttcaacatcggcggc
aacgatgttgccaattctttcggcaccagcgtcggtgcgggtacgctgaccatcccgcag
gctttgctgattgcggcggtatttgaggtcagcggcgcggtcatcgcgggcggcgaggta
accaataccatacgcaaaggcatcgtcgatttgaagggtgttgatttcgaacccatacag
tttgtgtttattatgatgtccgcgcttttggcggcggcgttgtggctgttgtttgcctcg
aaaaaagggcttccggtatctaccacccattccattatcggcggcattgtcggcagcgcg
gtatgtatggcggtaatgaacgatgccgcatcgggcgatttgatacgttggggcaagctg
ggcggtattggtgtttcttgggtattgtcgcccgtgttgggcggcgcggtgtcctatttt
ctgttttcgcgcgtcaagaaaaacgtcttagattacaacgcttgggcggaaggcacgctc
aagggcatcaagcaggaaaaaaaggcctataaagaacggcaccgcctgtttttcgagggt
ttgtccgaagccgaaaaagtcgagtacgccaccaaaatggcgcacgacgcgcaaatttac
gacgaacccgaattcgatccgcaagagctgcaatcggagtattaccgcggtctttatgcg
ttcgacaaccgtaaaaacaatgtcgattcctacaaggcactgcattcttggattcccttt
atcgcttcgttcggcgcgatgatgatttccgctatgctgattttcaagggcttgaaaaac
ctgcatttggggatgagcaacgtcaacagcttcctgaccatctttatgataggcgcggcg
gtgtggatggggacgtttgtttttgccaaaagcctcaagcgtaaagacttgggcaaatcg
acctttcagatgttttcatggatgcaggtctttaccgcctgcggcttcgcattcagccac
ggtgcgaacgatatcgccaacgccatcggtccgtttgccgcgattatggatgttttgcgt
accaacagcgttgccgcgcaaaatgtcgtccccccgattgcgatgctgactttcggcatc
gcgctgattgtcggtttgtggtttgtcggtaaagaggtgattaaaaccgtcggtacgagt
ttggcggaaatgcatcctgcttcgggttttaccgccgaactgtccgccgcctccgtcgtg
atgggcgcgtcgctgatggggctgcccgtgtccagtacgcatatcttggtcggcgcggta
ctcggtatcggtctggtcaaccgcaatgccaactggaaactgatgaagcccatcggtttg
gcgtgggtcattaccctgcctgccgccgccgtattgtcggttgtctgctacttggtttta
caggcagtattctga

DBGET integrated database retrieval system