KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0385Help
Entry
NMB0385           CDS       T00027                                 

Gene name
thiL
Definition
(RefSeq) thiamine monophosphate kinase
  KO
K00946  thiamine-monophosphate kinase [EC:2.7.4.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00730  Thiamine metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB0385 (thiL)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.16  thiamine-phosphate kinase
     NMB0385 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS AIRS_C
Motif
Other DBs
NCBI-GeneID: 902500
NCBI-ProteinID: NP_273434
UniProt: Q9K113
Position
387108..388064
Genome map
AA seq 318 aa AA seqDB search
MKEFDFIKRYLQTGTDNDVVLGIGDDAAIVRPREGFDLCFSADMLLKDRHFFADVKPEDL
AWKVLAVNISDMAAMGAIPRWVLLSAALPELDEVWLKRFCGSFFGLAKKFGVTLIGGDTT
KGDMAFNVTIIGELPKGRALRRDAAVAGDDIWVSGRIGMAAAALNCRLKRCVLPDEVFAE
CEQKLLHPEPRVGLGLALLPFARAAQDVSDGLAQDLGHILTASGKGAEIWADSLPSLSVL
KDILPRAQWLSYTLAGGDDYELVFTAPESCRSRVFDAAERCGVPVTRIGKINGGCRLKVL
DADGRELELHSLGFDHFG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttgacttcatcaaacggtatttgcaaacaggcacggataatgatgtcgta
ttgggcataggcgacgatgcggcgattgtccgcccgcgtgaaggcttcgatttgtgtttc
agtgcggatatgcttttgaaggacaggcatttttttgcagatgtcaaacctgaagacttg
gcttggaaggttttggccgtcaatatttcagatatggcggcgatgggtgcgataccgcgt
tgggtgttgctgagcgcggctttgcccgaattggatgaggtatggctgaaacggttttgc
ggcagctttttcggtttggcaaaaaagtttggcgtaacgttaatcggcggcgatacgacc
aagggcgatatggcgttcaatgtaaccattatcggcgaattgccgaagggtagggcgttg
cggcgtgatgcggcggttgcgggcgacgatatttgggtgtcggggcgtatcggtatggcg
gcggcggctttgaactgccgtctgaaacggtgtgtgttgccagatgaagtgtttgccgaa
tgcgaacaaaagctgctccatcctgaaccaagggttgggctggggcttgcgctgttgccg
tttgccagggcggcgcaggatgtttcagacggcctcgcgcaagatttggggcatatcctg
accgcttctggcaagggtgcggaaatttgggccgattcgctgccgtctttatccgtattg
aaagatattttgccccgagcgcaatggctgtcttatactttggcgggcggcgacgattac
gagctggtgtttaccgcgccggaaagttgccgcagccgcgtatttgatgcggcggaacgg
tgcggcgtgccggtaacgcgcatcggcaaaatcaacggaggatgccgtctgaaggtttta
gatgccgacggcagggaattggaactacattctttaggattcgatcattttggctga

DBGET integrated database retrieval system