KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0386Help
Entry
NMB0386           CDS       T00027                                 

Gene name
pgpA
Definition
(RefSeq) phosphatidylglycerophosphatase A
  KO
K01095  
phosphatidylglycerophosphatase A [EC:3.1.3.27]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB0386 (pgpA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.27  phosphatidylglycerophosphatase
     NMB0386 (pgpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
388057..388542
Genome map
AA seq 161 aa AA seqDB search
MADFKPDFAWLLKRPLCFLAFGFGSGLAPFAPGTFGTLAALPLAFVLILLGIDGLLLAFL
CIVLFMWGIRICAYAERETGVSDHGGIVWDEIVAMLFVLAFVPFRWTWWLAAFVLFRLFD
ALKPSPVGWFDKNLHGGLGIMADDMAAAVMTLIVLRIAMLF
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttggctgattttaaacctgactttgcgtggctgttgaaacggccgttgtgttttttggct
ttcggtttcggcagcgggctggctccgttcgcgccgggcacattcggcactttggcggca
ctgcctttggcgtttgtgctgattttgctcggcatagacgggctactgctggcttttttg
tgtatcgtgctgtttatgtggggcatacgcatttgcgcttatgcggaacgtgaaacgggt
gtcagcgaccacggtgggattgtttgggacgagattgtcgccatgctgtttgtgctggcg
tttgtgccgttcaggtggacgtggtggctggcggcatttgtcctattccgtctgtttgac
gcgctcaaaccgtctcccgtcggttggtttgacaagaatctgcacggcggtttgggcatt
atggcggacgatatggcggctgcggtgatgactttgattgtcttgaggattgcaatgctg
ttttaa

DBGET integrated database retrieval system