KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0389Help
Entry
NMB0389           CDS       T00027                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nme00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nme00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
392024..393034
Genome map
AA seq 336 aa AA seqDB search
MSDTPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVRENLVVSFDD
AASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHGLAVTRFNAV
AADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDDRLTVSYRATALGDTVFDPTLHIYW
RLDAGLHDAVLHIPQGGHMPADAEKLPVSTVSDDLEVFDFSRPKPLDAAVAALRRETGRA
GFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATE
AQTLPDSLNWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccgcgatttcggtctgatcgacgggcgtgccgtaaccggc
tatgtgctgtccaaccggcgtggtacgcgtgtctgcgtgctggacttgggcgggattgtg
caggaattttccgttttggcagacggcgtgcgcgaaaacctcgtggtgtcgttcgatgat
gcggcttcctatgcggacaatccgtttcagattaacaaacagatagggcgcgtggccgga
cgcatccgcggtgcggcgttcgacatcaacggcaggacttaccgcgtggaggccaacgaa
ggcaggaacgcgctgcacggcggttcgcacgggctggccgttacccgtttcaacgcggtg
gcggcagacggccgttcggtggtgctgcgcagccgcctgcaacagtcggccgacggttat
cccaacgatttggatttggatatttcctaccgcttggacgaggacgaccggcttaccgtt
agctatcgcgccaccgcgctcggcgacacggtgttcgacccgacgctgcacatttactgg
cggctggacgcgggcctgcacgatgcggttctgcatattccgcagggcggacatatgccg
gccgatgccgaaaaactgcccgtctcaacggtttcagacgacctcgaagtatttgatttc
agccggcccaagccgctggatgccgccgttgccgccctgcgccgcgaaacgggtcgggcc
ggttttgacgacgcttaccgcgtgccgtccgatataggccgtcccgccgctgtgttgcaa
gccggacgccgccgtcgtatcagcatatacagcgaccgcaatggcttggtcatctttacc
gccgccccgcaggatttcgcgcggcacgatgcgggcgtttacgacgcgctggcgaccgag
gcgcagacgctgcccgacagcctgaattggcccgagttcggcaatattcgtctgaacaag
ggtgataccagggaggcgacgattgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system