KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0390Help
Entry
NMB0390           CDS       T00027                                 

Gene name
mapA
Definition
(RefSeq) maltose phosphorylase
  KO
K00691  
maltose phosphorylase [EC:2.4.1.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NMB0390 (mapA)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.8  maltose phosphorylase
     NMB0390 (mapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
393268..395526
Genome map
AA seq 752 aa AA seqDB search
MYTRIMEISPWTLRSAKLEKEHKRLQESLTSLGNGYMGMRGSFEETYSADSHLGTYIAGV
WFPDKTRVGWWKNGYPKYFGKAINAFNFSKVKIFVDGQEVDLAKNDVAGFSVELDMQHGV
LRRSFTVFGVRFNVCKFLSVAQKELAVIRWEAVSVDGKTHQVRIDSIIDADVKNEDSNYE
EKFWQVLDKGVSDSLSYIAAQTVANPFGVEQFIVNAEQTFAGSFKALGGSQTDWQVSNSF
ESEVGSTPETFEKRVIVTTSRDYQSLEAVKAAGRALSEKIAGVAFETLLDAHKAGWLHRW
EIADVVIEGSDEAQQGIRFNLFQLFSTYYGEDARLNIGPKGFTGEKYGGATYWDTEAYAV
PLYLALAEPEVTRNLLQYRRNQLPQAQHNAREQGLAGALYPMVTFTGIECHNEWEITFEE
IHRNGAIPYAIYNYTNYTGDEGYLAKEGLEVLVEVSRFWADRVHFSKRNGKYMIHGVTGP
NEYENNINNNWYTNTLAAWVLDYTREALAKYPRPDLNVRADELEKWADISANMYRPHDEE
LGVFVQHDGFLDKDIRPVSALSPDDLPLNQKWSWDKILRSPFIKQADVLQGIYFFSDRFN
IDEKRRNFDFYEPMTVHESSLSPCIHSILAAELGKEEKAVEMYQRTARLDLDNYNNDTED
GLHITSMTGSWLAIVQGFAQMKTWGGKLSFAPFLPSAWTGYAFHINYRGRLIKVAVGKEN
VVFTLLKGESLDLQVYGKDITLDGSHTVALEK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtacacaagaatcatggaaatcagcccttggacgctgcgttcggcaaaactggaaaaa
gaacacaaacggctgcaagagagcctgaccagcttgggcaacggctatatgggtatgcgc
ggcagctttgaggaaacctattccgccgacagccacttaggcacctacatcgccggcgtg
tggttccccgacaaaacccgcgtcggctggtggaaaaacggctatcccaaatatttcggc
aaagccatcaacgcgttcaatttcagcaaagtcaaaatctttgtcgacgggcaggaagtg
gacttggcgaaaaacgacgttgctggcttctccgtcgaactcgatatgcagcacggcgtg
ttgcgccgctcgttcaccgtattcggtgtgcgtttcaatgtgtgcaaattcctgtctgtc
gcacaaaaagagctggcggtcatccgctgggaagccgtatccgttgacggtaaaacccac
caagtccgcatcgattccatcatcgatgccgacgtgaaaaacgaagactccaactacgaa
gaaaaattctggcaggtattggacaaaggcgtttcagacagtctctcctacattgccgcc
caaaccgtcgccaatcccttcggcgtggaacaattcatcgtcaacgccgagcaaaccttt
gccggcagcttcaaagccctcggcggcagccaaaccgactggcaggtctccaattctttt
gaatccgaagtcggcagcacacccgaaacctttgaaaaacgcgtgattgttaccaccagc
cgcgattatcagagcttggaagcagtgaaagccgcaggccgcgccttgtcggaaaaaatt
gcaggcgttgcgtttgaaaccttgctggacgcgcacaaagcaggctggctgcaccgttgg
gaaatcgccgacgtggtcatcgaaggcagcgacgaagcgcagcagggcatccgcttcaac
ctgttccaactgttctccacctactacggcgaagacgcgcgactgaacatcggcccgaaa
ggctttaccggcgaaaaatacggcggcgcgacctattgggacaccgaagcctacgccgta
ccgctctacctcgcactggccgaacccgaagttacccgcaacctgctgcaataccgccgc
aaccaactgccgcaggcgcagcacaacgcgcgcgaacagggcttggcgggcgcactctat
ccgatggtaacgtttacgggcatcgagtgccacaacgaatgggaaatcaccttcgaggaa
atccaccgcaacggcgcgattccttacgccatctacaactacaccaactacaccggcgac
gagggctatcttgccaaagaaggcttggaagttttggtcgaagtgtcccgcttctgggcg
gaccgcgtccacttctccaaacgcaacggcaaatacatgattcacggcgtaaccggtccg
aacgaatacgaaaacaacatcaacaacaactggtacaccaacaccctcgccgcatgggta
ttggactacacccgcgaagccttggcgaaatacccgcgtccggatttgaacgtgcgtgcc
gacgagttggaaaaatgggcggacatcagcgcgaatatgtaccgtccgcatgacgaagaa
ctcggcgtattcgtgcagcacgacggcttcctcgacaaagacatccgccccgtgtccgcg
ctttcgcccgacgatttgccgctcaaccaaaaatggtcgtgggacaaaatcctgcgttcg
ccctttatcaaacaggcggacgtattgcaaggcatctacttcttcagcgaccgtttcaat
atcgacgaaaaacgccgcaacttcgacttctacgaaccgatgaccgtgcatgaaagctcg
ctgtcgccctgtattcactctattctcgccgccgaactgggcaaagaagaaaaagccgtg
gaaatgtaccagcgcaccgcccgcctggacttggacaactacaacaacgacaccgaagac
ggcctgcacatcacctccatgaccggctcgtggctcgccatcgtccaaggtttcgcccaa
atgaaaacctggggcggcaaactcagcttcgcaccgttcctgccgagtgcgtggacaggc
tacgccttccacatcaactaccgcggccgtctgattaaagtcgccgtcggcaaagaaaac
gtcgtcttcactctgctcaaaggcgagtcgctcgatttgcaggtgtacggcaaagacatc
acgctcgacggcagccacaccgttgcgttggaaaaataa

DBGET integrated database retrieval system