KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0394Help
Entry
NMB0394           CDS       T00027                                 

Gene name
nadA
Definition
(RefSeq) quinolinate synthetase
  KO
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB0394 (nadA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     NMB0394 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(398426..399538)
Genome map
AA seq 370 aa AA seqDB search
MQTAARRSFDYDMPLIQTPTSACQIRQAWAKVADTPDRETADRLKDEIKALLKEKNAVLV
AHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKTVL
MPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIVSY
LKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPEAVVLV
HPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQAPDKQFIAAPTA
GNGGSCKSCAFCPWMAMNSLGGIKYALTSGRNEILLDRKLGEAAKLPLQRMLDFAAGLKK
KDVFNGMGPA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgccgcccgccgctcgttcgactacgatatgccactcatccaaacgccgact
tccgcctgccaaatccgtcaggcgtgggcgaaggttgccgacacgcccgaccgcgagacg
gcagatcgtctgaaagacgaaatcaaggctttgctgaaggagaaaaacgcggtcttggtg
gcgcattattacgttgatccgctgattcaggatttggctttggagacgggcggatgcgtg
ggcgattcgctggaaatggcgcgcttcggtgcggaacacgaagccggtacgctggtggtg
gctggtgtgcgcttcatgggcgagagcgcgaaaatcctctgccctgaaaaaacggtgctg
atgcctgatttggaggcggaatgttctttggatttgggttgcccggaagaagcgttttca
gcgttttgcgaccaacaccccgaccgcacggtggtggtgtacgccaacacttccgccgcc
gtgaaagcgcgtgccgattgggtggtaacgtcttcggtggcgttagaaatcgtatcgtat
ttgaaatcacgcggcgagaagctgatttggggacccgaccgccacctcggcgactacatc
tgccgcgaaacgggcgcggatatgctgttgtggcagggttcgtgcatcgttcacaacgaa
ttcaaagggcaagagctggcggcgttgaaggcggaacaccccgaagcggtggtgctggtt
catcctgaatcgccgcaaagcgtcatcgaactgggcgacgtggtcggctcgaccagcaaa
ctgctcaaagccgccgtatcgcgtcctgaaaaaaaattcatcgtggcgaccgatttgggc
atcctgcacgaaatgcaaaagcaggcgcccgacaaacaatttatcgccgcgccgacggcg
ggcaacggtggaagctgtaaaagctgcgcgttctgcccgtggatggcgatgaattcgctg
ggcggcatcaaatacgccctgacaagcggacgtaacgaaatcctgttggacaggaagctg
ggcgaagccgccaaactgcctttgcagcgtatgctcgactttgcggcagggctgaagaaa
aaagatgtgttcaacggcatgggccccgcctga

DBGET integrated database retrieval system