KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0396Help
Entry
NMB0396           CDS       T00027                                 

Gene name
nadC
Definition
(RefSeq) nicotinate-nucleotide pyrophosphorylase
  KO
K00767  
nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB0396 (nadC)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     NMB0396 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
400896..401777
Genome map
AA seq 293 aa AA seqDB search
MPSEKTLFPLPDTLLRPIVEQALSEDLGRRGDITSAAVIAPDKTAKLFLVSREDGVIAGM
DLARLAFQTMDPSVRFQAEIRDGQAVRAGQTLAAVEGNARALLAAERTALNYLTHLSGIA
TATARAVAEVAEYGTDIVCSRKTIPLLRVLQKYAVRAGGGVNHRMGLDDAVLIKDNHLAY
CGSIAQAVQQAKQAVGALTCVEIEVDTLAQLDEAIAAGAERILLDNMDDETLKEAANRCH
TQTAHPHTIYCEASGGIGFDRLKRVAQTGVDGIALGYLTHSSRSLDIGLDFVA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaaaaccctctttcccctgcccgacaccctgttgcgccccatagtagaa
caagccttgagcgaagacttgggcaggcgcggcgatattacgtccgccgccgtcatcgcc
cccgacaaaaccgccaaactcttccttgtcagccgcgaagacggcgttatcgccggcatg
gacttggcgcgtctcgcctttcagacgatggatccgtccgtccgcttccaagccgaaatc
cgagacgggcaagccgtccgcgcaggtcagacgcttgccgccgtcgaaggcaacgcccgc
gcgctgctcgccgccgaacgcaccgcgctcaactacctcacgcacttaagcggcatcgcc
accgccaccgcgcgtgccgttgccgaagtcgccgaatacggtacagacatcgtgtgcagc
cgcaaaaccatccccctgctgcgtgtcctgcaaaaatacgccgtcagggcaggcggcggt
gtgaaccaccgcatgggtttggacgacgccgtgctcatcaaagacaaccacctcgcctat
tgcggcagcatcgcccaagccgtgcagcaggcaaaacaggctgtcggagcattgacctgc
gtggaaatcgaagtggatacgttggcacaactggacgaagccatcgcagcgggcgcggaa
cggattttgctggataacatggacgacgaaaccctgaaagaagcggcaaaccgctgccac
acgcaaaccgcccacccccacaccatctattgcgaagcatcgggcggcatcggcttcgac
cgcctgaagcgcgtggcgcaaaccggagtggacggcatcgccctcggctatctgacccac
agcagccgttcgttggacataggtttggatttcgtggcgtga

DBGET integrated database retrieval system