KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0401Help
Entry
NMB0401           CDS       T00027                                 

Gene name
putA
Definition
(RefSeq) bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  
RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0401 (putA)
   00330 Arginine and proline metabolism
    NMB0401 (putA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     NMB0401 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     NMB0401 (putA)
Transcription factors [BR:nme03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    NMB0401 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(405844..409449)
Genome map
AA seq 1201 aa AA seqDB search
MFHFAFPAQTALRQAITDAYRRNEIEAVQDMLQRAQMSDEERNAASELARRLVTQVRAGR
TKAGGVDALMHEFSLSSEEGIALMCLAEALLRIPDNATRDRLIADKISDGNWKSHLNNSP
SLFVNAAAWGLLITGKLTATNDKQMSSALSRLISKGGAPLIRQGVNYAMRLLGKQFVTGQ
TIEEALQNGKEREKMGYRFSFDMLGEAAYTQADADRYYRDYVEAIHAIGKDAAGQGVYEG
NGISVKLSAIHPRYSRTQHGRVMGELLPRLKELFLLGKKYDIGINIDAEEANRLELSLDL
MEALVSDPDLAGYKGIGFVVQAYQKRCPFVIDYLIDLARRNNQKLMIRLVKGAYWDSEIK
WAQVDGLNGYPTYTRKVHTDISYLACARKLLSAQDAVFPQFATHNAYTLGAIYQMGKGKD
FEHQCLHGMGETLYDQVVGPQNLGRRVRVYAPVGTHETLLAYLVRRLLENGANSSFVNQI
VDENISIDTLIRSPFDTIAEQGIHLHNALPLPRDLYGKCRLNSQGVDLSNENVLQQLQEQ
MNKAAAQDFHAASIVNGKARDVGEAQPIKNPADHDDIVGTVSFADAALAQEAVGAAVAAF
PEWSATPAAERAACLRRFADLLEQHTPALMMLAVREAGKTLNNAIAEVREAVDFCRYYAN
EAEHTLPQDAKAVGAIVAISPWNFPLAIFTGEVVSALAAGNTVIAKPAEQTSLIAGYAVS
LMHEAGIPTSALQLVLGAGDVGAALTNDARIGGVIFTGSTEVARLINKALAKRGDNPVLI
AETGGQNAMIVDSTALAEQVCADVLNSAFDSAGQRCSALRILCVQEDVADRMLDMIKGAM
DELVVGKPIQLTTDVGPVIDAEAQQNLLNHINKMKGVAKSYHEVKTAADVDSKKSTFVRP
ILFELNNLNELQREVFGPVLHVVRYRADELDNVIDQINSKGYALTHGVHSRIEGTVRHIR
SRIEAGNVYVNRNIVGAVVGVQPFGGHGLSGTGPKAGGSFYLQKLTRAGEWVAPTLSQIG
QADEAALKRLEALVHKLPFNAEEKKAAAAALGHARIRTLRRAETVLTGPTGERNSISWHA
PKRVWIHGGSTVQAFAALTELAASGIQAVVEPDSPLASYTADLEGLLLVNGKPETAGISH
VAALSPLDSARKQELAAHDGALIRILPSENGLDILQVFEEISCSVNTTAAGGNASLMAVA
D
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattttgcatttccggcacaaactgccctgcgccaagcgataaccgatgcctac
cgccgtaatgaaatcgaagccgtacaggatatgttgcaacgtgcacagatgagcgacgaa
gagcgcaacgccgcctccgagcttgcccgccgtttggttacccaagtccgcgccggccgc
accaaagccggcggcgtggatgcgctgatgcacgagttttcactctccagcgaagaaggc
atcgcgctgatgtgtctggcagaagccctgctgcgtatccccgacaacgccacgcgcgac
cgcctgattgccgacaagatttcagacggcaactggaaaagccatttgaacaacagccct
tccctcttcgtcaatgctgccgcctggggcctgctgattaccggcaaactgaccgccaca
aacgacaaacaaatgagttccgcactcagccgcctgatcagcaaaggcggcgcaccgctc
atccgccaaggcgtaaattacgccatgcggcttctgggcaaacagttcgtaaccggacag
accattgaagaagccctgcaaaacggcaaagaacgcgaaaaaatgggctaccgcttctcc
ttcgatatgttgggcgaagccgcctacacccaagccgatgccgaccgctactaccgcgac
tatgtcgaagccatccacgccatcggcaaagatgcggcaggacaaggcgtttacgaaggt
aacggtatttccgtcaaactttccgccatccatccgcgctactcgcgcacccaacacggc
cgcgtgatgggcgaactgttgccgcgcctgaaagagctgttccttttgggtaaaaaatac
gatatcggtatcaacatcgatgccgaagaagccaaccgtctggagctgtctttggatttg
atggaggctttggtttcagaccctgacttggctggctacaaaggtatcggtttcgttgtc
caagcctaccaaaaacgttgtccgttcgttatcgactacctgatcgaccttgcccgccgc
aacaaccaaaaactaatgatccgcctcgtcaaaggcgcgtattgggacagcgaaatcaaa
tgggcgcaagtggacggcttgaacggctatccgacctacacccgcaaagtccacaccgac
atctcctacctcgcctgcgcgcgcaaactgctttccgcgcaagacgcggtattcccgcaa
tttgccacccacaacgcctacactttgggcgcaatctaccaaatgggtaaaggcaaagat
tttgaacaccaatgcctgcacggtatgggcgaaaccctgtacgaccaagtcgtcggcccg
caaaacttaggccgccgcgtgcgcgtgtacgccccagtcggcacacacgaaaccctgctc
gcctacttggtgcgccgcctgttggaaaacggcgcgaactcgtctttcgtcaaccaaatc
gtcgatgaaaacatcagcatcgacacgctcatccgcagcccgttcgacaccatcgccgaa
caaggcatccacctgcacaacgccctgccgctgccgcgcgatttgtacggcaaatgccgt
ctgaactcgcaaggcgtggacttgagcaacgaaaacgtattgcagcagcttcaagaacag
atgaacaaagccgccgcgcaagacttccacgccgcatccatcgtcaacggcaaagcccgc
gatgtcggcgaagcgcaaccgattaaaaaccctgccgaccacgacgacatcgtcggcaca
gtcagctttgccgatgccgcgcttgcccaagaagcggttggcgcagccgttgccgcgttc
cccgaatggagtgcgacacctgccgccgaacgcgccgcctgcctgcgccgttttgccgat
ttgctggagcagcacaccccagcactgatgatgcttgccgtgcgcgaagcaggcaaaacg
ctgaacaacgccattgccgaagtgcgcgaagccgtcgatttctgccgctactacgcaaac
gaagccgaacataccctgcctcaagacgcaaaagccgtcggcgcgattgtcgccatcagc
ccgtggaacttcccgctcgccatctttaccggcgaagtcgtttccgcattggcggcaggc
aacaccgtcatcgccaaacccgccgaacaaaccagcctgattgccggttatgccgtttcc
ctcatgcacgaagccggcatcccgacttccgccctgcaactcgtcctcggcgcaggcgac
gtgggtgcggcattgaccaacgatgcccgcatcggcggcgtgattttcaccggctcgacc
gaagtggcgcgcctgatcaacaaagcccttgccaaacgcggcgacaatcccgtcctgatt
gccgaaaccggcggacaaaacgccatgattgtcgattccaccgcacttgccgagcaagtc
tgcgccgacgtattgaactccgccttcgacagcgcgggacaacgctgctccgccctgcgc
attttgtgcgtccaagaagacgttgccgaccgtatgctcgacatgatcaaaggcgctatg
gacgaactcgtcgtcggcaaaccgattcagctcactaccgatgtcggccccgtcatcgat
gccgaagcacagcaaaacctgttgaaccacatcaacaaaatgaaaggtgttgccaagtcc
taccacgaagtcaaaaccgccgccgatgtcgattccaaaaaatccacgttcgttcgcccc
atcctgtttgaattgaacaacctcaacgaactgcaacgcgaagtcttcggtcccgtcctg
cacgtcgtccgctaccgcgccgacgaactcgacaacgtcatcgaccaaatcaacagcaaa
ggctacgccctgacccacggcgtacacagccgcatcgaaggcacggtacgccacatccgc
agccgcatcgaagccggcaacgtttacgtcaaccgcaacatcgtcggcgcagtcgtcggc
gtacagcccttcggcggacacggtctgtccggcacaggccccaaagcaggcggttcgttc
tacctgcaaaaactgacccgcgccggcgaatgggttgccccgaccctgagccaaatcgga
caggcggacgaagccgcactcaaacgcctcgaagcactggttcacaaactaccgttcaac
gccgaagagaaaaaagccgcagcggccgctttgggacacgcccgcatccgcaccctgcgc
cgtgccgaaaccgtccttaccggaccgaccggcgagcgcaacagcatctcatggcacgcg
cccaaacgcgtttggatacacggcggcagcacggttcaagcctttgccgcactgaccgaa
cttgccgcctccggcatacaggcagtggtcgaacccgacagccccttggcttcctacact
gccgacttggaaggtctgctgctggtcaacggcaaacccgaaaccgccggcatcagccac
gttgccgccctgtcgcctttggacagcgcgcgcaaacaggaacttgccgcccacgacggc
gcactcatccgcatcctcccttcggaaaacggactcgacatcctgcaagtgtttgaagaa
atctcttgcagcgtcaacaccacagccgccggcggcaacgccagcctgatggcggtcgcc
gactga

DBGET integrated database retrieval system